Opened 2 years ago
Closed 2 years ago
#9614 closed defect (duplicate)
MatchMaker: KeyError with domain matching
Reported by: | Owned by: | pett | |
---|---|---|---|
Priority: | normal | Milestone: | |
Component: | Structure Comparison | Version: | |
Keywords: | Cc: | ||
Blocked By: | Blocking: | ||
Notify when closed: | Platform: | all | |
Project: | ChimeraX |
Description
The following bug report has been submitted: Platform: macOS-10.16-x86_64-i386-64bit ChimeraX Version: 1.6.1 (2023-05-09 17:57:07 UTC) Description (Describe the actions that caused this problem to occur here) Log: UCSF ChimeraX version: 1.6.1 (2023-05-09) © 2016-2023 Regents of the University of California. All rights reserved. How to cite UCSF ChimeraX > ui tool show AlphaFold > alphafold predict > MDFNSLAYDQKFFNFTAAQLSAEREHIVQDIIKKGIGQIIDKIKTPATAELLEAEKETVERRFQASASKGLKALRELDSKVFHVPPHVLHPEHMFVENQYTSEEEEQKTARLEELKAKYRENMAMLAHLKIEEEKYAAMEDLIQKEIEMQDRVQRSCSSLNITKLKQFWNQVPLQIKKETD,MEDSEAAFKRHEGVGPKVKQAYEEAIKQIFADLSCADLQAWDAIYQEHEQSALDTESIVDRTRSLMTKVVLEMNRCFFASNDVPNKLQTLEMLKEHFAAYEGKKWNVNTAAPDKLTRPLRMRFLDFSVEFMEQQLASQAKELEIAMAKSNANRERLQHVHDKRLKLTVQMEQQLSQYEKVKTELIKLGEALNDF,MEPAESPEKLMKFVRRSDVLEYVGNTSAVDLSSGDLSDIDLKDVPAQLEATLKPRRYEASTLFNIDLDDIWDPSCQEDEVQQYKERAQKEQQKFFDFVMHAALDTDNRKVSFKPNKEQQRYLDQGPNLQNFVRSSLAFTNAAIRFQAEHEDMMELQCNMDDHYLFMRNTMINNAIHQNMANQR,MSKPQNNDTLELDDILSQPVKDKERFAAFMMRKLAENKPAQNDNLFGNFKLDFDLDFEVPLIKKSQAKPKSKLPEVQPLGELVSKNSAATEKVN Please cite ColabFold: Making protein folding accessible to all. Nature Methods (2022) if you use these predictions. Running AlphaFold prediction AlphaFold prediction finished Results in /Users/fpelisch/Downloads/ChimeraX/AlphaFold/prediction_2 > open > /Users/fpelisch/Downloads/ChimeraX/AlphaFold/prediction_2/best_model.pdb Chain information for best_model.pdb #1 --- Chain | Description A | No description available B | No description available C | No description available D | No description available > set bgColor white > sequence chain #1/A Alignment identifier is 1/A > select /A:1 8 atoms, 7 bonds, 1 residue, 1 model selected > select /A 1485 atoms, 1509 bonds, 181 residues, 1 model selected > color sel forest green > sequence chain #1/B Alignment identifier is 1/B > color sel dark gray > sequence chain #1/C Alignment identifier is 1/C > color sel cyan > sequence chain #1/D Alignment identifier is 1/D > select /B:1 8 atoms, 7 bonds, 1 residue, 1 model selected > select /B 1576 atoms, 1601 bonds, 194 residues, 1 model selected > color sel dark gray > select /C:1 8 atoms, 7 bonds, 1 residue, 1 model selected > select /C 1498 atoms, 1525 bonds, 183 residues, 1 model selected > color sel cyan > select /A:1-2 16 atoms, 15 bonds, 2 residues, 1 model selected > select /A 1485 atoms, 1509 bonds, 181 residues, 1 model selected > color sel forest green > select /D:1-2 14 atoms, 13 bonds, 2 residues, 1 model selected > select /D 746 atoms, 758 bonds, 94 residues, 1 model selected > color sel magenta > select /A:129 8 atoms, 7 bonds, 1 residue, 1 model selected > select /A:129 8 atoms, 7 bonds, 1 residue, 1 model selected > show sel atoms > select /A:126 8 atoms, 7 bonds, 1 residue, 1 model selected > select /A:126 8 atoms, 7 bonds, 1 residue, 1 model selected > show sel atoms > select /A:3-13,17-43,49-54,56-81,91-97,102-138,140-159,162-180 1254 atoms, 1262 bonds, 153 residues, 1 model selected > select /A:112 8 atoms, 7 bonds, 1 residue, 1 model selected > select /A:112 8 atoms, 7 bonds, 1 residue, 1 model selected > select /A:112,115 16 atoms, 14 bonds, 2 residues, 1 model selected > show sel atoms > select /A:12 11 atoms, 11 bonds, 1 residue, 1 model selected > select /A:12-13 22 atoms, 23 bonds, 2 residues, 1 model selected > select /A:12-13,15-16 40 atoms, 41 bonds, 4 residues, 1 model selected > show sel atoms > select /B:41 14 atoms, 15 bonds, 1 residue, 1 model selected > select /B:41 14 atoms, 15 bonds, 1 residue, 1 model selected > select /A:3-13,17-43,49-54,56-81,91-97,102-138,140-159,162-180 1254 atoms, 1262 bonds, 153 residues, 1 model selected > select /B:41 14 atoms, 15 bonds, 1 residue, 1 model selected > select /B:41 14 atoms, 15 bonds, 1 residue, 1 model selected > select /B:41,45 26 atoms, 27 bonds, 2 residues, 1 model selected > select /B:41,45-46 35 atoms, 36 bonds, 3 residues, 1 model selected > select /B:44 8 atoms, 7 bonds, 1 residue, 1 model selected > select /B:44-45 20 atoms, 20 bonds, 2 residues, 1 model selected > select /B:41,44-45 34 atoms, 35 bonds, 3 residues, 1 model selected > show sel atoms > select /D:26 11 atoms, 11 bonds, 1 residue, 1 model selected > show sel atoms > select /D:29 11 atoms, 11 bonds, 1 residue, 1 model selected > select /D:29 11 atoms, 11 bonds, 1 residue, 1 model selected > show sel atoms > select /D:29 11 atoms, 11 bonds, 1 residue, 1 model selected > select /D:29 11 atoms, 11 bonds, 1 residue, 1 model selected > select /D:26-27,29 27 atoms, 27 bonds, 3 residues, 1 model selected > select /D:26 11 atoms, 11 bonds, 1 residue, 1 model selected > select /D:26 11 atoms, 11 bonds, 1 residue, 1 model selected > select /D:26,29 22 atoms, 22 bonds, 2 residues, 1 model selected > ui tool show Contacts > contacts sel interModel false intraMol false ignoreHiddenModels true select > true color #000000 reveal true 16 contacts > select /D:38-39 16 atoms, 16 bonds, 2 residues, 1 model selected > select /D:38-94 446 atoms, 454 bonds, 57 residues, 1 model selected Drag select of 113 atoms, 390 residues, 106 bonds, 16 pseudobonds > hide sel atoms > open "/Users/fpelisch/OneDrive - University of Dundee/C. elegans centromere > kinetochore project/MIS12/MIS-12C_HCP-4 model/MIS12C_HCP-4.pdb" Chain information for MIS12C_HCP-4.pdb #2 --- Chain | Description A | No description available B | No description available C | No description available D | No description available E | No description available > select 9236 atoms, 9366 bonds, 16 pseudobonds, 1138 residues, 3 models selected > show sel cartoons > hide sel atoms > sequence chain #2/A Alignment identifier is 2/A > select #2/A 1028 atoms, 1046 bonds, 127 residues, 1 model selected > color sel lime > select #2/B 1064 atoms, 1072 bonds, 132 residues, 1 model selected > color sel light gray > select #2/C 507 atoms, 510 bonds, 64 residues, 1 model selected > color sel blue > select #2/E 856 atoms, 865 bonds, 105 residues, 1 model selected > color sel hot pink > ui tool show Matchmaker > matchmaker #2/E to #1/D pairing ss Parameters --- Chain pairing | ss Alignment algorithm | Needleman-Wunsch Similarity matrix | BLOSUM-62 SS fraction | 0.3 Gap open (HH/SS/other) | 18/18/6 Gap extend | 1 SS matrix | | | H | S | O ---|---|---|--- H | 6 | -9 | -6 S | | 6 | -6 O | | | 4 Iteration cutoff | 2 Matchmaker best_model.pdb, chain D (#1) with MIS12C_HCP-4.pdb, chain E (#2), sequence alignment score = 39.7 RMSD between 6 pruned atom pairs is 1.019 angstroms; (across all 30 pairs: 9.556) > ui tool show Matchmaker > matchmaker #2/A to #1/A pairing ss Parameters --- Chain pairing | ss Alignment algorithm | Needleman-Wunsch Similarity matrix | BLOSUM-62 SS fraction | 0.3 Gap open (HH/SS/other) | 18/18/6 Gap extend | 1 SS matrix | | | H | S | O ---|---|---|--- H | 6 | -9 | -6 S | | 6 | -6 O | | | 4 Iteration cutoff | 2 Matchmaker best_model.pdb, chain A (#1) with MIS12C_HCP-4.pdb, chain A (#2), sequence alignment score = 156.4 RMSD between 26 pruned atom pairs is 0.842 angstroms; (across all 116 pairs: 5.832) > select #2/D 476 atoms, 480 bonds, 58 residues, 1 model selected > color sel orange Drag select of 32 residues > hide sel cartoons Drag select of 1 residues > hide sel cartoons Drag select of 5 residues > hide sel cartoons Drag select of 181 residues > hide sel cartoons > ui tool show "Show Sequence Viewer" > sequence chain #2/A Destroying pre-existing alignment with identifier 2/A Alignment identifier is 2/A > sequence chain #2/B Alignment identifier is 2/B > sequence chain #2/C Alignment identifier is 2/C > sequence chain #2/D Alignment identifier is 2/D > sequence chain #2/E Alignment identifier is 2/E > select #2/E:33 11 atoms, 10 bonds, 1 residue, 1 model selected > select #2/E:33 11 atoms, 10 bonds, 1 residue, 1 model selected > select #2/E:33,36 23 atoms, 22 bonds, 2 residues, 1 model selected > show sel atoms > style sel stick Changed 23 atom styles > select #1/D:26 11 atoms, 11 bonds, 1 residue, 1 model selected > select #1/D:26 11 atoms, 11 bonds, 1 residue, 1 model selected > select #1/D:26,29 22 atoms, 22 bonds, 2 residues, 1 model selected > show sel atoms > style sel stick Changed 22 atom styles > hide #!1 models > select #2/E:1-2 16 atoms, 15 bonds, 2 residues, 1 model selected > select #2/E 856 atoms, 865 bonds, 105 residues, 1 model selected > hide sel cartoons Drag select of 23 atoms, 381 residues, 22 bonds > hide sel atoms > open "/Users/fpelisch/OneDrive - University of Dundee/C. elegans centromere > kinetochore project/MIS12/elegans MIS-12C > (rank_2_model_2_ptm_seed_0_unrelaxed).pdb" Chain information for elegans MIS-12C (rank_2_model_2_ptm_seed_0_unrelaxed).pdb #3 --- Chain | Description A | No description available B | No description available C | No description available D | No description available > hide #2 models > select #1/A#2/A#3/A 3722 atoms, 3775 bonds, 457 residues, 3 models selected > color (#3 & sel) forest green > select #1/D#2/D#3/D 2636 atoms, 2675 bonds, 327 residues, 3 models selected > color (#3 & sel) orange > select #1/C#2/C#3/C 4691 atoms, 4760 bonds, 590 residues, 3 models selected > color (#3 & sel) orange > select ~sel 11173 atoms, 11315 bonds, 16 pseudobonds, 1378 residues, 4 models selected > hide sel & #3 cartoons > hide #3 models > show #2 models > select #2/C:1 8 atoms, 7 bonds, 1 residue, 1 model selected > select #2/C 507 atoms, 510 bonds, 64 residues, 1 model selected > color sel orange > select #2/D:1 6 atoms, 5 bonds, 1 residue, 1 model selected > select #2/D 476 atoms, 480 bonds, 58 residues, 1 model selected > color sel cyan > select #2/C:53 9 atoms, 8 bonds, 1 residue, 1 model selected > select #2/C:53-55 25 atoms, 24 bonds, 3 residues, 1 model selected > select #2/C:10-11 13 atoms, 12 bonds, 2 residues, 1 model selected > select #2/C:1-11 84 atoms, 83 bonds, 11 residues, 1 model selected > ui tool show Contacts > contacts sel interModel false intraMol false ignoreHiddenModels true select > true color #000000 reveal true 6 contacts > hide sel atoms Drag select of 6 atoms, 54 residues > hide sel atoms > show #3 models > hide #!2 models > select 15864 atoms, 16075 bonds, 22 pseudobonds, 1968 residues, 5 models selected > show sel & #3 cartoons > hide sel & #3 atoms > select #1/A:3 11 atoms, 11 bonds, 1 residue, 1 model selected > select #1/A:3-139 1116 atoms, 1136 bonds, 137 residues, 1 model selected > select #1/A:181 8 atoms, 7 bonds, 1 residue, 1 model selected > select #1/A:156-181 213 atoms, 216 bonds, 26 residues, 1 model selected > select add #3 6841 atoms, 6925 bonds, 856 residues, 2 models selected > select subtract #3 213 atoms, 216 bonds, 26 residues, 1 model selected > close #1-2 > ui tool show "Show Sequence Viewer" > sequence chain /A Alignment identifier is 3/A > select /A:149 9 atoms, 8 bonds, 1 residue, 1 model selected > select /A 1209 atoms, 1220 bonds, 149 residues, 1 model selected > close > ui tool show AlphaFold > alphafold predict > MTTPSPQEISTVTLNSLSKEERKKAILALQTKKNEIKLVIDEHQKKLAEFRQSIPDGCCEMFENEKKIRLKHSSTAELLPHLQKVGSSSVDKEKMINNIRQRVEVQVADQETFKSIEERNELLRRENENLKKEVNTVAAELLQEFESYE,DDSTQLELLMAKIPQEMSGYMKKLATDIKEMSQYDAQLARNIDDMEAVFKSRETKLKSAIEIAKDSFISSALPLRLETLDMTLRKEESPNDIVARLHGSFLDKTQDAGNVNTAQKENQQLEDERGMLEEKLESLNKIKREKDEFLAKMRKEEEEALARREEIKQGFERIDALMSKIKPIPIFEF,DPAVVNVVYLTSEDPSTEQHPEALKFQRIVENEKMKVQHEIDSLNSTNQLSAEKIDMLKTKELLKFSHDEREAIMIARKDAEIKFLELRLKFALEKKIESDQEIAELEQGNSKMAEQLRGLDKMAVVQKELEKLRSLPPSREESGKIRKEWMEMKQWEFDQKMKALRNVRSNMIALRSEKNALEMKVAEEHEKFAQRNDLKKSRMLVFSKAVKKIVNF Running AlphaFold prediction > alphafold predict > MTTPSPQEISTVTLNSLSKEERKKAILALQTKKNEIKLVIDEHQKKLAEFRQSIPDGCCEMFENEKKIRLKHSSTAELLPHLQKVGSSSVDKEKMINNIRQRVEVQVADQETFKSIEERNELLRRENENLKKEVNTVAAELLQEFESYE,DDSTQLELLMAKIPQEMSGYMKKLATDIKEMSQYDAQLARNIDDMEAVFKSRETKLKSAIEIAKDSFISSALPLRLETLDMTLRKEESPNDIVARLHGSFLDKTQDAGNVNTAQKENQQLEDERGMLEEKLESLNKIKREKDEFLAKMRKEEEEALARREEIKQGFERIDALMSKIKPIPIFEF,DPAVVNVVYLTSEDPSTEQHPEALKFQRIVENEKMKVQHEIDSLNSTNQLSAEKIDMLKTKELLKFSHDEREAIMIARKDAEIKFLELRLKFALEKKIESDQEIAELEQGNSKMAEQLRGLDKMAVVQKELEKLRSLPPSREESGKIRKEWMEMKQWEFDQKMKALRNVRSNMIALRSEKNALEMKVAEEHEKFAQRNDLKKSRMLVFSKAVKKIVNF Running AlphaFold prediction AlphaFold prediction finished Results in /Users/fpelisch/Downloads/ChimeraX/AlphaFold/prediction_2 > open > /Users/fpelisch/Downloads/ChimeraX/AlphaFold/prediction_2/best_model.pdb Chain information for best_model.pdb #1 --- Chain | Description A | No description available B | No description available C | No description available > sequence chain #1/A Alignment identifier is 1/A > sequence chain #1/B Alignment identifier is 1/B > sequence chain #1/C Alignment identifier is 1/C > select /A:1 8 atoms, 7 bonds, 1 residue, 1 model selected > select /A 1209 atoms, 1220 bonds, 149 residues, 1 model selected > color sel cyan > select /B:1 8 atoms, 7 bonds, 1 residue, 1 model selected > select /B 1486 atoms, 1500 bonds, 184 residues, 1 model selected > color sel orange > select /C:1 8 atoms, 7 bonds, 1 residue, 1 model selected > select /C 1789 atoms, 1810 bonds, 218 residues, 1 model selected > color sel purple > open "/Users/fpelisch/OneDrive - University of Dundee/C. elegans centromere > kinetochore project/MIS12/elegans MIS-12C > (rank_2_model_2_ptm_seed_0_unrelaxed).pdb" Chain information for elegans MIS-12C (rank_2_model_2_ptm_seed_0_unrelaxed).pdb #2 --- Chain | Description A | No description available B | No description available C | No description available D | No description available > hide #1 models Drag select of 830 residues > hide sel cartoons > select #2/C 2686 atoms, 2725 bonds, 343 residues, 1 model selected > show sel cartoons > ui tool show "Show Sequence Viewer" > sequence chain #2/C Alignment identifier is 2/C > select #2/C:1 8 atoms, 7 bonds, 1 residue, 1 model selected > select #2/C:1-157 1186 atoms, 1210 bonds, 157 residues, 1 model selected > hide sel cartoons > select #2/C:268 8 atoms, 7 bonds, 1 residue, 1 model selected > select #2/C:268-343 637 atoms, 642 bonds, 76 residues, 1 model selected > show #1 models > ui tool show Matchmaker > matchmaker #2/C & sel to #1/B pairing ss Traceback (most recent call last): File "/Applications/ChimeraX-1.6.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/chimerax/match_maker/tool.py", line 288, in run_matchmaker run(self.session, cmd) File "/Applications/ChimeraX-1.6.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/chimerax/core/commands/run.py", line 38, in run results = command.run(text, log=log, return_json=return_json) File "/Applications/ChimeraX-1.6.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/chimerax/core/commands/cli.py", line 2897, in run result = ci.function(session, **kw_args) File "/Applications/ChimeraX-1.6.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/chimerax/match_maker/match.py", line 730, in cmd_match ret_vals = match(session, pairing, match_items, matrix, alg, gap_open, gap_extend, File "/Applications/ChimeraX-1.6.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/chimerax/match_maker/match.py", line 314, in match score, s1, s2 = align(session, ref, match, final_matrix_name[match], alg, KeyError: <chimerax.atomic.molobject.StructureSeq object at 0x7fdfb3066b50> KeyError: File "/Applications/ChimeraX-1.6.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/chimerax/match_maker/match.py", line 314, in match score, s1, s2 = align(session, ref, match, final_matrix_name[match], alg, See log for complete Python traceback. OpenGL version: 4.1 ATI-4.5.14 OpenGL renderer: AMD Radeon Pro 580 OpenGL Engine OpenGL vendor: ATI Technologies Inc. Python: 3.9.11 Locale: UTF-8 Qt version: PyQt6 6.4.2, Qt 6.4.2 Qt runtime version: 6.4.3 Qt platform: cocoa Hardware: Hardware Overview: Model Name: iMac Model Identifier: iMac18,3 Processor Name: Quad-Core Intel Core i7 Processor Speed: 4.2 GHz Number of Processors: 1 Total Number of Cores: 4 L2 Cache (per Core): 256 KB L3 Cache: 8 MB Hyper-Threading Technology: Enabled Memory: 32 GB System Firmware Version: 429.120.4.0.0 SMC Version (system): 2.41f2 Software: System Software Overview: System Version: macOS 11.4 (20F71) Kernel Version: Darwin 20.5.0 Time since boot: 8 days 20:24 Graphics/Displays: Radeon Pro 580: Chipset Model: Radeon Pro 580 Type: GPU Bus: PCIe PCIe Lane Width: x16 VRAM (Total): 8 GB Vendor: AMD (0x1002) Device ID: 0x67df Revision ID: 0x00c0 ROM Revision: 113-D000AA-931 VBIOS Version: 113-D0001A1X-025 EFI Driver Version: 01.00.931 Metal Family: Supported, Metal GPUFamily macOS 2 Displays: iMac: Display Type: Built-In Retina LCD Resolution: Retina 5K (5120 x 2880) Framebuffer Depth: 30-Bit Color (ARGB2101010) Main Display: Yes Mirror: Off Online: Yes Automatically Adjust Brightness: Yes Connection Type: Internal Installed Packages: alabaster: 0.7.13 appdirs: 1.4.4 appnope: 0.1.3 asttokens: 2.2.1 Babel: 2.12.1 backcall: 0.2.0 beautifulsoup4: 4.11.2 blockdiag: 3.0.0 build: 0.10.0 certifi: 2021.10.8 cftime: 1.6.2 charset-normalizer: 3.1.0 ChimeraX-AddCharge: 1.5.9.1 ChimeraX-AddH: 2.2.5 ChimeraX-AlignmentAlgorithms: 2.0.1 ChimeraX-AlignmentHdrs: 3.3.1 ChimeraX-AlignmentMatrices: 2.1 ChimeraX-Alignments: 2.9.3 ChimeraX-AlphaFold: 1.0 ChimeraX-AltlocExplorer: 1.0.3 ChimeraX-AmberInfo: 1.0 ChimeraX-Arrays: 1.1 ChimeraX-Atomic: 1.43.10 ChimeraX-AtomicLibrary: 10.0.6 ChimeraX-AtomSearch: 2.0.1 ChimeraX-AxesPlanes: 2.3.2 ChimeraX-BasicActions: 1.1.2 ChimeraX-BILD: 1.0 ChimeraX-BlastProtein: 2.1.2 ChimeraX-BondRot: 2.0.1 ChimeraX-BugReporter: 1.0.1 ChimeraX-BuildStructure: 2.8 ChimeraX-Bumps: 1.0 ChimeraX-BundleBuilder: 1.2.2 ChimeraX-ButtonPanel: 1.0.1 ChimeraX-CageBuilder: 1.0.1 ChimeraX-CellPack: 1.0 ChimeraX-Centroids: 1.3.2 ChimeraX-ChangeChains: 1.0.2 ChimeraX-CheckWaters: 1.3.1 ChimeraX-ChemGroup: 2.0.1 ChimeraX-Clashes: 2.2.4 ChimeraX-ColorActions: 1.0.3 ChimeraX-ColorGlobe: 1.0 ChimeraX-ColorKey: 1.5.3 ChimeraX-CommandLine: 1.2.5 ChimeraX-ConnectStructure: 2.0.1 ChimeraX-Contacts: 1.0.1 ChimeraX-Core: 1.6.1 ChimeraX-CoreFormats: 1.1 ChimeraX-coulombic: 1.4.2 ChimeraX-Crosslinks: 1.0 ChimeraX-Crystal: 1.0 ChimeraX-CrystalContacts: 1.0.1 ChimeraX-DataFormats: 1.2.3 ChimeraX-Dicom: 1.2 ChimeraX-DistMonitor: 1.4 ChimeraX-DockPrep: 1.1.1 ChimeraX-Dssp: 2.0 ChimeraX-EMDB-SFF: 1.0 ChimeraX-ESMFold: 1.0 ChimeraX-FileHistory: 1.0.1 ChimeraX-FunctionKey: 1.0.1 ChimeraX-Geometry: 1.3 ChimeraX-gltf: 1.0 ChimeraX-Graphics: 1.1.1 ChimeraX-Hbonds: 2.4 ChimeraX-Help: 1.2.1 ChimeraX-HKCage: 1.3 ChimeraX-IHM: 1.1 ChimeraX-ImageFormats: 1.2 ChimeraX-IMOD: 1.0 ChimeraX-IO: 1.0.1 ChimeraX-ItemsInspection: 1.0.1 ChimeraX-Label: 1.1.7 ChimeraX-ListInfo: 1.1.1 ChimeraX-Log: 1.1.5 ChimeraX-LookingGlass: 1.1 ChimeraX-Maestro: 1.8.2 ChimeraX-Map: 1.1.4 ChimeraX-MapData: 2.0 ChimeraX-MapEraser: 1.0.1 ChimeraX-MapFilter: 2.0.1 ChimeraX-MapFit: 2.0 ChimeraX-MapSeries: 2.1.1 ChimeraX-Markers: 1.0.1 ChimeraX-Mask: 1.0.2 ChimeraX-MatchMaker: 2.0.12 ChimeraX-MDcrds: 2.6 ChimeraX-MedicalToolbar: 1.0.2 ChimeraX-Meeting: 1.0.1 ChimeraX-MLP: 1.1.1 ChimeraX-mmCIF: 2.12 ChimeraX-MMTF: 2.2 ChimeraX-Modeller: 1.5.9 ChimeraX-ModelPanel: 1.3.7 ChimeraX-ModelSeries: 1.0.1 ChimeraX-Mol2: 2.0 ChimeraX-Mole: 1.0 ChimeraX-Morph: 1.0.2 ChimeraX-MouseModes: 1.2 ChimeraX-Movie: 1.0 ChimeraX-Neuron: 1.0 ChimeraX-Nifti: 1.0 ChimeraX-NRRD: 1.0 ChimeraX-Nucleotides: 2.0.3 ChimeraX-OpenCommand: 1.10.1 ChimeraX-PDB: 2.7.2 ChimeraX-PDBBio: 1.0 ChimeraX-PDBLibrary: 1.0.2 ChimeraX-PDBMatrices: 1.0 ChimeraX-PickBlobs: 1.0.1 ChimeraX-Positions: 1.0 ChimeraX-PresetMgr: 1.1 ChimeraX-PubChem: 2.1 ChimeraX-ReadPbonds: 1.0.1 ChimeraX-Registration: 1.1.1 ChimeraX-RemoteControl: 1.0 ChimeraX-RenderByAttr: 1.1 ChimeraX-RenumberResidues: 1.1 ChimeraX-ResidueFit: 1.0.1 ChimeraX-RestServer: 1.1 ChimeraX-RNALayout: 1.0 ChimeraX-RotamerLibMgr: 3.0 ChimeraX-RotamerLibsDunbrack: 2.0 ChimeraX-RotamerLibsDynameomics: 2.0 ChimeraX-RotamerLibsRichardson: 2.0 ChimeraX-SaveCommand: 1.5.1 ChimeraX-SchemeMgr: 1.0 ChimeraX-SDF: 2.0.1 ChimeraX-Segger: 1.0 ChimeraX-Segment: 1.0.1 ChimeraX-SelInspector: 1.0 ChimeraX-SeqView: 2.8.3 ChimeraX-Shape: 1.0.1 ChimeraX-Shell: 1.0.1 ChimeraX-Shortcuts: 1.1.1 ChimeraX-ShowSequences: 1.0.1 ChimeraX-SideView: 1.0.1 ChimeraX-Smiles: 2.1 ChimeraX-SmoothLines: 1.0 ChimeraX-SpaceNavigator: 1.0 ChimeraX-StdCommands: 1.10.3 ChimeraX-STL: 1.0.1 ChimeraX-Storm: 1.0 ChimeraX-StructMeasure: 1.1.2 ChimeraX-Struts: 1.0.1 ChimeraX-Surface: 1.0.1 ChimeraX-SwapAA: 2.0.1 ChimeraX-SwapRes: 2.2.1 ChimeraX-TapeMeasure: 1.0 ChimeraX-Test: 1.0 ChimeraX-Toolbar: 1.1.2 ChimeraX-ToolshedUtils: 1.2.1 ChimeraX-Topography: 1.0 ChimeraX-Tug: 1.0.1 ChimeraX-UI: 1.28.4 ChimeraX-uniprot: 2.2.2 ChimeraX-UnitCell: 1.0.1 ChimeraX-ViewDockX: 1.2 ChimeraX-VIPERdb: 1.0 ChimeraX-Vive: 1.1 ChimeraX-VolumeMenu: 1.0.1 ChimeraX-VTK: 1.0 ChimeraX-WavefrontOBJ: 1.0 ChimeraX-WebCam: 1.0.2 ChimeraX-WebServices: 1.1.1 ChimeraX-Zone: 1.0.1 colorama: 0.4.6 comm: 0.1.3 contourpy: 1.0.7 cxservices: 1.2.2 cycler: 0.11.0 Cython: 0.29.33 debugpy: 1.6.7 decorator: 5.1.1 docutils: 0.19 executing: 1.2.0 filelock: 3.9.0 fonttools: 4.39.3 funcparserlib: 1.0.1 grako: 3.16.5 h5py: 3.8.0 html2text: 2020.1.16 idna: 3.4 ihm: 0.35 imagecodecs: 2022.9.26 imagesize: 1.4.1 importlib-metadata: 6.6.0 ipykernel: 6.21.1 ipython: 8.10.0 ipython-genutils: 0.2.0 ipywidgets: 8.0.6 jedi: 0.18.2 Jinja2: 3.1.2 jupyter-client: 8.0.2 jupyter-core: 5.3.0 jupyterlab-widgets: 3.0.7 kiwisolver: 1.4.4 line-profiler: 4.0.2 lxml: 4.9.2 lz4: 4.3.2 MarkupSafe: 2.1.2 matplotlib: 3.6.3 matplotlib-inline: 0.1.6 msgpack: 1.0.4 nest-asyncio: 1.5.6 netCDF4: 1.6.2 networkx: 2.8.8 nibabel: 5.0.1 nptyping: 2.5.0 numexpr: 2.8.4 numpy: 1.23.5 openvr: 1.23.701 packaging: 21.3 ParmEd: 3.4.3 parso: 0.8.3 pep517: 0.13.0 pexpect: 4.8.0 pickleshare: 0.7.5 Pillow: 9.3.0 pip: 23.0 pkginfo: 1.9.6 platformdirs: 3.5.0 prompt-toolkit: 3.0.38 psutil: 5.9.4 ptyprocess: 0.7.0 pure-eval: 0.2.2 pycollada: 0.7.2 pydicom: 2.3.0 Pygments: 2.14.0 pynrrd: 1.0.0 PyOpenGL: 3.1.5 PyOpenGL-accelerate: 3.1.5 pyparsing: 3.0.9 pyproject-hooks: 1.0.0 PyQt6-commercial: 6.4.2 PyQt6-Qt6: 6.4.3 PyQt6-sip: 13.4.1 PyQt6-WebEngine-commercial: 6.4.0 PyQt6-WebEngine-Qt6: 6.4.3 python-dateutil: 2.8.2 pytz: 2023.3 pyzmq: 25.0.2 qtconsole: 5.4.0 QtPy: 2.3.1 RandomWords: 0.4.0 requests: 2.28.2 scipy: 1.9.3 setuptools: 67.4.0 setuptools-scm: 7.0.5 sfftk-rw: 0.7.3 six: 1.16.0 snowballstemmer: 2.2.0 sortedcontainers: 2.4.0 soupsieve: 2.4.1 sphinx: 6.1.3 sphinx-autodoc-typehints: 1.22 sphinxcontrib-applehelp: 1.0.4 sphinxcontrib-blockdiag: 3.0.0 sphinxcontrib-devhelp: 1.0.2 sphinxcontrib-htmlhelp: 2.0.1 sphinxcontrib-jsmath: 1.0.1 sphinxcontrib-qthelp: 1.0.3 sphinxcontrib-serializinghtml: 1.1.5 stack-data: 0.6.2 tables: 3.7.0 tcia-utils: 1.2.0 tifffile: 2022.10.10 tinyarray: 1.2.4 tomli: 2.0.1 tornado: 6.3.1 traitlets: 5.9.0 typing-extensions: 4.5.0 tzdata: 2023.3 urllib3: 1.26.15 wcwidth: 0.2.6 webcolors: 1.12 wheel: 0.38.4 wheel-filename: 1.4.1 widgetsnbextension: 4.0.7 zipp: 3.15.0
Attachments (1)
Change History (4)
comment:1 by , 2 years ago
Component: | Unassigned → Structure Comparison |
---|---|
Owner: | set to |
Platform: | → all |
Project: | → ChimeraX |
Status: | new → accepted |
Summary: | ChimeraX bug report submission → MatchMaker: KeyError with domain matching |
by , 2 years ago
comment:2 by , 2 years ago
Note:
See TracTickets
for help on using tickets.
Repeat with attached session and: matchmaker #1/C & sel to #2/B pairing ss