Opened 3 years ago
Closed 3 years ago
#8516 closed defect (nonchimerax)
glClear: invalid framebuffer operation
| Reported by: | Owned by: | Tom Goddard | |
|---|---|---|---|
| Priority: | normal | Milestone: | |
| Component: | Graphics | Version: | |
| Keywords: | Cc: | ||
| Blocked By: | Blocking: | ||
| Notify when closed: | Platform: | all | |
| Project: | ChimeraX |
Description
The following bug report has been submitted:
Platform: macOS-10.16-x86_64-i386-64bit
ChimeraX Version: 1.3 (2021-12-08 23:08:33 UTC)
Description
(Describe the actions that caused this problem to occur here)
Log:
UCSF ChimeraX version: 1.3 (2021-12-08)
© 2016-2021 Regents of the University of California. All rights reserved.
How to cite UCSF ChimeraX
> MKASLQLKMGQQLAMTPQLQQAIRLLQLSTLDLQQEIQEALDSNPLLDVEEEALSTPETLTSPEPQAEKE
Unknown command:
MKASLQLKMGQQLAMTPQLQQAIRLLQLSTLDLQQEIQEALDSNPLLDVEEEALSTPETLTSPEPQAEKE
> TASAEQETPVTDSSDVIESNNISEELEMDASWDDVYSANSGSTGLAIDDDTPIYQGETTESLQDYLMWQA
Unknown command:
TASAEQETPVTDSSDVIESNNISEELEMDASWDDVYSANSGSTGLAIDDDTPIYQGETTESLQDYLMWQA
> DLTPFTDLDRTIATTIIESLDEYGYLTSSLDDILESIGDEEVEMDEVEAVLKRIQQFDPLGVASRDLAEC
Unknown command:
DLTPFTDLDRTIATTIIESLDEYGYLTSSLDDILESIGDEEVEMDEVEAVLKRIQQFDPLGVASRDLAEC
> LLLQLATYPADTPWLPETKLILKDHINLLGNRDYRQLAKETKLKESDLKQVMMLIHELDPRPGNRVIDTE
Unknown command:
LLLQLATYPADTPWLPETKLILKDHINLLGNRDYRQLAKETKLKESDLKQVMMLIHELDPRPGNRVIDTE
> TEYVIPDVSVFKHNGKWVVTINPDSVPRLKVNAEYAALGKTMGNTPDGQFIRTNLQEAKWLIKSLESRNE
Unknown command:
TEYVIPDVSVFKHNGKWVVTINPDSVPRLKVNAEYAALGKTMGNTPDGQFIRTNLQEAKWLIKSLESRNE
> TLLKVARCIVEHQQDFFEYGEEAMKPMVLNDIALDVDMHESTISRVTTQKFMHIPRGIFELKYFFSSHVS
Unknown command:
TLLKVARCIVEHQQDFFEYGEEAMKPMVLNDIALDVDMHESTISRVTTQKFMHIPRGIFELKYFFSSHVS
> TDNGGECSSTAIRALVKKLVAAENQAKPLSDSKIATLLAEQGIQVARRTIAKYRESLGIAPSNQRKRLL
Unknown command:
TDNGGECSSTAIRALVKKLVAAENQAKPLSDSKIATLLAEQGIQVARRTIAKYRESLGIAPSNQRKRLL
> open /Users/chrismuriel/Desktop/RpoN_VF_2.rtf
Unrecognized file suffix '.rtf'
> open /Users/chrismuriel/Desktop/RpoN_VF_2.rtf
Unrecognized file suffix '.rtf'
> open "/Users/chrismuriel/Desktop/2023_RpoN_alignment
> analysis/Alignment_Analysis/AlignedRPONVcenae Consensus.fa"
Summary of feedback from opening
/Users/chrismuriel/Desktop/2023_RpoN_alignment
analysis/Alignment_Analysis/AlignedRPONVcenae Consensus.fa
---
note | Alignment identifier is AlignedRPONVcenae Consensus.fa
Opened 1 sequences from AlignedRPONVcenae Consensus.fa
> save "/Users/chrismuriel/Desktop/2023_RpoN_alignment
> analysis/Alignment_Analysis/consensus rpoN" format aln alignment
> "AlignedRPONVcenae Consensus.fa"
> open "/Users/chrismuriel/Desktop/2023_RpoN_alignment
> analysis/Alignment_Analysis/consensus rpoN" format aln
Summary of feedback from opening
/Users/chrismuriel/Desktop/2023_RpoN_alignment
analysis/Alignment_Analysis/consensus rpoN
---
note | Alignment identifier is consensus rpoN
Opened 1 sequences from consensus rpoN
> open "/Users/chrismuriel/Desktop/2023_RpoN_alignment
> analysis/Alignment_Analysis/consensus rpoN" format aln
Summary of feedback from opening
/Users/chrismuriel/Desktop/2023_RpoN_alignment
analysis/Alignment_Analysis/consensus rpoN
---
notes | Destroying pre-existing alignment with identifier consensus rpoN
Alignment identifier is consensus rpoN
Opened 1 sequences from consensus rpoN
> open "/Users/chrismuriel/Desktop/2023_RpoN_alignment
> analysis/Alignment_Analysis/consensus rpoN" format aln
Summary of feedback from opening
/Users/chrismuriel/Desktop/2023_RpoN_alignment
analysis/Alignment_Analysis/consensus rpoN
---
notes | Destroying pre-existing alignment with identifier consensus rpoN
Alignment identifier is consensus rpoN
Opened 1 sequences from consensus rpoN
> show atoms
[Repeated 2 time(s)]
> open "/Users/chrismuriel/Desktop/2023_RpoN_alignment
> analysis/Alignment_Analysis/consensus rpoN" format aln
Summary of feedback from opening
/Users/chrismuriel/Desktop/2023_RpoN_alignment
analysis/Alignment_Analysis/consensus rpoN
---
notes | Destroying pre-existing alignment with identifier consensus rpoN
Alignment identifier is consensus rpoN
Opened 1 sequences from consensus rpoN
> open "/Users/chrismuriel/Desktop/2023_RpoN_alignment
> analysis/Alignment_Analysis/consensus rpoN" format aln
Summary of feedback from opening
/Users/chrismuriel/Desktop/2023_RpoN_alignment
analysis/Alignment_Analysis/consensus rpoN
---
note | Alignment identifier is consensus rpoN
Opened 1 sequences from consensus rpoN
> show # target m
Expected a collection of one of 'atoms', 'bonds', 'cartoons', 'models',
'pbonds', 'pseudobonds', 'ribbons', or 'surfaces' or a keyword
> open /Users/chrismuriel/Downloads/AF-A0A510UNU5-F1-model_v3.pdb format pdb
Summary of feedback from opening
/Users/chrismuriel/Downloads/AF-A0A510UNU5-F1-model_v3.pdb
---
warning | Ignored bad PDB record found on line 38
DBREF XXXX A 1 489 UNP A0A510UNU5 A0A510UNU5_ALIFS 1 489
AF-A0A510UNU5-F1-model_v3.pdb title:
Alphafold monomer V2.0 prediction for RNA polymerase σ-54 factor (A0A510UNU5)
[more info...]
Chain information for AF-A0A510UNU5-F1-model_v3.pdb #1
---
Chain | Description
A | RNA polymerase σ-54 factor
> select #1
3850 atoms, 3910 bonds, 489 residues, 1 model selected
Alignment identifier is 1/A
> select /A:488-489
17 atoms, 16 bonds, 2 residues, 1 model selected
> select /A:1-489
3850 atoms, 3910 bonds, 489 residues, 1 model selected
Destroying pre-existing alignment with identifier 1/A
Alignment identifier is 1/A
> select /A:1
8 atoms, 7 bonds, 1 residue, 1 model selected
> select /A:1-329
2574 atoms, 2614 bonds, 329 residues, 1 model selected
> select /A:1
8 atoms, 7 bonds, 1 residue, 1 model selected
> select /A:1-489
3850 atoms, 3910 bonds, 489 residues, 1 model selected
> select /A:1
8 atoms, 7 bonds, 1 residue, 1 model selected
> select /A:1-489
3850 atoms, 3910 bonds, 489 residues, 1 model selected
> ~select #1
Nothing selected
> select /A:454
8 atoms, 7 bonds, 1 residue, 1 model selected
> select /A:454-489
284 atoms, 285 bonds, 36 residues, 1 model selected
> color sel orange
> hide #1 models
> show #1 models
> show target m
[Repeated 2 time(s)]
> hide target m
> show target m
> view clip false
[Repeated 1 time(s)]
> save /Users/chrismuriel/Desktop/image1.png supersample 3
> hide sel cartoons
> show sel cartoons
> hide sel surfaces
[Repeated 2 time(s)]
> hide sel atoms
[Repeated 2 time(s)]
> hide sel cartoons
[Repeated 2 time(s)]
> show sel cartoons
> show sel surfaces
[Repeated 1 time(s)]
> hide sel surfaces
> show sel atoms
> hide sel atoms
> hide #!1 models
> show #!1 models
> select #1
3850 atoms, 3910 bonds, 489 residues, 1 model selected
> ~select #1
1 model selected
> select #1
3850 atoms, 3910 bonds, 489 residues, 1 model selected
> ~select #1
1 model selected
> select /A:454
8 atoms, 7 bonds, 1 residue, 1 model selected
> select /A:454-489
284 atoms, 285 bonds, 36 residues, 1 model selected
> view sel
> lighting soft
[Repeated 1 time(s)]
> lighting simple
> set bgColor gray
> set bgColor white
> select #1
3850 atoms, 3910 bonds, 489 residues, 1 model selected
> ~select #1
1 model selected
> set bgColor white
> set bgColor gray
> set bgColor black
> select
> /A:17-27,30-43,132-142,147-158,170-177,184-196,207-216,225-234,236-240,244-250,255-267,272-275,303-305,313-321,326-362,364-369,371-373,379-386,390-397,411-414,429-441,451-460,467-477,482-485
1886 atoms, 1883 bonds, 234 residues, 1 model selected
> select /A:366
11 atoms, 11 bonds, 1 residue, 1 model selected
> select /A:366-378
109 atoms, 112 bonds, 13 residues, 1 model selected
> select /A:366
11 atoms, 11 bonds, 1 residue, 1 model selected
> select /A:366-382
141 atoms, 144 bonds, 17 residues, 1 model selected
> color (#!1 & sel) orange red
> set bgColor white
> lighting soft
> lighting simple
> lighting full
> lighting flat
> lighting shadows true intensity 0.5
> lighting simple
> lighting soft
> lighting simple
> set bgColor gray
> set bgColor white
> select #1
3850 atoms, 3910 bonds, 489 residues, 1 model selected
> ~select #1
1 model selected
> lighting soft
> nucleotides ladder
[Repeated 1 time(s)]
> nucleotides stubs
> nucleotides atoms
> style nucleic stick
Changed 0 atom styles
> show atoms
[Repeated 2 time(s)]
> hide atoms
> show cartoons
[Repeated 2 time(s)]
> show surfaces
> hide surfaces
> style stick
Changed 3850 atom styles
> style stick
Changed 3850 atom styles
> style sphere
Changed 3850 atom styles
> color bfactor
3850 atoms, 489 residues, 1 surfaces, atom bfactor range 22.8 to 91.4
> color bfactor
3850 atoms, 489 residues, 1 surfaces, atom bfactor range 22.8 to 91.4
> undo
[Repeated 1 time(s)]
> hbonds reveal true
370 hydrogen bonds found
> ~hbonds
> undo
> select #1
3850 atoms, 3910 bonds, 489 residues, 3 models selected
> ~select #1
1 model selected
> select /A:366
11 atoms, 11 bonds, 1 residue, 1 model selected
> select /A:366-386
169 atoms, 172 bonds, 21 residues, 1 model selected
> select /A:451
8 atoms, 7 bonds, 1 residue, 1 model selected
> select /A:451-489
307 atoms, 308 bonds, 39 residues, 1 model selected
> select /A:366
11 atoms, 11 bonds, 1 residue, 1 model selected
> select /A:366-379
117 atoms, 120 bonds, 14 residues, 1 model selected
> select /A:451
8 atoms, 7 bonds, 1 residue, 1 model selected
> select /A:451-489
307 atoms, 308 bonds, 39 residues, 1 model selected
> color (#!1 & sel) orange
> select /A:366
11 atoms, 11 bonds, 1 residue, 1 model selected
> select /A:366-382
141 atoms, 144 bonds, 17 residues, 1 model selected
> color (#!1 & sel) red
> select /A:451
8 atoms, 7 bonds, 1 residue, 1 model selected
> select /A:451-489
307 atoms, 308 bonds, 39 residues, 1 model selected
> select /A:366
11 atoms, 11 bonds, 1 residue, 1 model selected
> select /A:366-386
169 atoms, 172 bonds, 21 residues, 1 model selected
> view sel
> select #1
3850 atoms, 3910 bonds, 489 residues, 3 models selected
> ~select #1
1 model selected
> lighting soft
[Repeated 1 time(s)]
> lighting shadows true intensity 0.5
> lighting full
> lighting flat
> lighting soft
> lighting full
> ui tool show "Side View"
> view orient
[Repeated 1 time(s)]
> save "/Users/chrismuriel/RpoN protein.png" width 1104 height 668 supersample
> 3
> view
> select /A:56
7 atoms, 6 bonds, 1 residue, 1 model selected
> select /A:1-56
435 atoms, 436 bonds, 56 residues, 1 model selected
> select /A:85-86
15 atoms, 14 bonds, 2 residues, 1 model selected
> select /A:59-86
205 atoms, 207 bonds, 28 residues, 1 model selected
> select /A:105
7 atoms, 6 bonds, 1 residue, 1 model selected
> select /A:86-105
159 atoms, 160 bonds, 20 residues, 1 model selected
> select /A:120-121
15 atoms, 14 bonds, 2 residues, 1 model selected
> select /A:105-121
117 atoms, 117 bonds, 17 residues, 1 model selected
> select /A:250-251
16 atoms, 15 bonds, 2 residues, 1 model selected
> select /A:120-251
1058 atoms, 1076 bonds, 132 residues, 1 model selected
> select /A:385-386
15 atoms, 14 bonds, 2 residues, 1 model selected
> select /A:250-386
1100 atoms, 1120 bonds, 137 residues, 1 model selected
> select /A:386-387
15 atoms, 14 bonds, 2 residues, 1 model selected
> select /A:386-489
812 atoms, 823 bonds, 104 residues, 1 model selected
Traceback (most recent call last):
File
"/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/core/triggerset.py", line 134, in invoke
return self._func(self._name, data)
File
"/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/sideview/tool.py", line 112, in _redraw
self.render()
File
"/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/sideview/tool.py", line 276, in render
self.view.draw()
File
"/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/graphics/view.py", line 165, in draw
self._draw_scene(camera, drawings)
File
"/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/graphics/view.py", line 215, in _draw_scene
camera.draw_background(vnum, r)
File
"/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/graphics/camera.py", line 184, in draw_background
render.draw_background()
File
"/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/graphics/opengl.py", line 1166, in draw_background
GL.glClear(flags)
File "src/errorchecker.pyx", line 58, in
OpenGL_accelerate.errorchecker._ErrorChecker.glCheckError
OpenGL.error.GLError: GLError(
err = 1286,
description = b'invalid framebuffer operation',
baseOperation = glClear,
cArguments = (16640,)
)
Error processing trigger "frame drawn":
OpenGL.error.GLError: GLError(
err = 1286,
description = b'invalid framebuffer operation',
baseOperation = glClear,
cArguments = (16640,)
)
File "src/errorchecker.pyx", line 58, in
OpenGL_accelerate.errorchecker._ErrorChecker.glCheckError
See log for complete Python traceback.
Back buffer dpr of 2 doesn't match <_NSViewBackingLayer: 0x6000024f34e0>
contents scale of 1 - updating layer to match.
[Repeated 4 time(s)]
Back buffer dpr of 1 doesn't match <_NSViewBackingLayer: 0x6000024f34e0>
contents scale of 2 - updating layer to match.
[Repeated 2 time(s)]
Back buffer dpr of 2 doesn't match <_NSViewBackingLayer: 0x6000024f34e0>
contents scale of 1 - updating layer to match.
OpenGL version: 4.1 INTEL-20.2.44
OpenGL renderer: Intel(R) HD Graphics 615
OpenGL vendor: Intel Inc.Hardware:
Hardware Overview:
Model Name: MacBook
Model Identifier: MacBook10,1
Processor Name: Dual-Core Intel Core m3
Processor Speed: 1.2 GHz
Number of Processors: 1
Total Number of Cores: 2
L2 Cache (per Core): 256 KB
L3 Cache: 4 MB
Hyper-Threading Technology: Enabled
Memory: 8 GB
System Firmware Version: 499.40.2.0.0
OS Loader Version: 564.40.4~27
SMC Version (system): 2.42f13
Software:
System Software Overview:
System Version: macOS 13.0.1 (22A400)
Kernel Version: Darwin 22.1.0
Time since boot: 6 days, 19 hours, 1 minute
Graphics/Displays:
Intel HD Graphics 615:
Chipset Model: Intel HD Graphics 615
Type: GPU
Bus: Built-In
VRAM (Dynamic, Max): 1536 MB
Vendor: Intel
Device ID: 0x591e
Revision ID: 0x0002
Metal Support: Metal 3
Displays:
Color LCD:
Display Type: Built-In Retina LCD
Resolution: 2304 x 1440 Retina
Framebuffer Depth: 24-Bit Color (ARGB8888)
Main Display: Yes
Mirror: Off
Online: Yes
Automatically Adjust Brightness: Yes
Connection Type: Internal
Locale: (None, 'UTF-8')
PyQt5 5.15.2, Qt 5.15.2
Installed Packages:
alabaster: 0.7.12
appdirs: 1.4.4
appnope: 0.1.2
Babel: 2.9.1
backcall: 0.2.0
blockdiag: 2.0.1
certifi: 2021.5.30
cftime: 1.5.1.1
charset-normalizer: 2.0.9
ChimeraX-AddCharge: 1.2.2
ChimeraX-AddH: 2.1.11
ChimeraX-AlignmentAlgorithms: 2.0
ChimeraX-AlignmentHdrs: 3.2
ChimeraX-AlignmentMatrices: 2.0
ChimeraX-Alignments: 2.2.3
ChimeraX-AlphaFold: 1.0
ChimeraX-AltlocExplorer: 1.0.1
ChimeraX-AmberInfo: 1.0
ChimeraX-Arrays: 1.0
ChimeraX-Atomic: 1.31
ChimeraX-AtomicLibrary: 4.2
ChimeraX-AtomSearch: 2.0
ChimeraX-AtomSearchLibrary: 1.0
ChimeraX-AxesPlanes: 2.0
ChimeraX-BasicActions: 1.1
ChimeraX-BILD: 1.0
ChimeraX-BlastProtein: 2.0
ChimeraX-BondRot: 2.0
ChimeraX-BugReporter: 1.0
ChimeraX-BuildStructure: 2.6.1
ChimeraX-Bumps: 1.0
ChimeraX-BundleBuilder: 1.1
ChimeraX-ButtonPanel: 1.0
ChimeraX-CageBuilder: 1.0
ChimeraX-CellPack: 1.0
ChimeraX-Centroids: 1.2
ChimeraX-ChemGroup: 2.0
ChimeraX-Clashes: 2.2.2
ChimeraX-ColorActions: 1.0
ChimeraX-ColorGlobe: 1.0
ChimeraX-ColorKey: 1.5
ChimeraX-CommandLine: 1.1.5
ChimeraX-ConnectStructure: 2.0
ChimeraX-Contacts: 1.0
ChimeraX-Core: 1.3
ChimeraX-CoreFormats: 1.1
ChimeraX-coulombic: 1.3.2
ChimeraX-Crosslinks: 1.0
ChimeraX-Crystal: 1.0
ChimeraX-CrystalContacts: 1.0
ChimeraX-DataFormats: 1.2.2
ChimeraX-Dicom: 1.0
ChimeraX-DistMonitor: 1.1.5
ChimeraX-DistUI: 1.0
ChimeraX-Dssp: 2.0
ChimeraX-EMDB-SFF: 1.0
ChimeraX-ExperimentalCommands: 1.0
ChimeraX-FileHistory: 1.0
ChimeraX-FunctionKey: 1.0
ChimeraX-Geometry: 1.1
ChimeraX-gltf: 1.0
ChimeraX-Graphics: 1.1
ChimeraX-Hbonds: 2.1.2
ChimeraX-Help: 1.2
ChimeraX-HKCage: 1.3
ChimeraX-IHM: 1.1
ChimeraX-ImageFormats: 1.2
ChimeraX-IMOD: 1.0
ChimeraX-IO: 1.0.1
ChimeraX-ItemsInspection: 1.0
ChimeraX-Label: 1.1
ChimeraX-ListInfo: 1.1.1
ChimeraX-Log: 1.1.4
ChimeraX-LookingGlass: 1.1
ChimeraX-Maestro: 1.8.1
ChimeraX-Map: 1.1
ChimeraX-MapData: 2.0
ChimeraX-MapEraser: 1.0
ChimeraX-MapFilter: 2.0
ChimeraX-MapFit: 2.0
ChimeraX-MapSeries: 2.1
ChimeraX-Markers: 1.0
ChimeraX-Mask: 1.0
ChimeraX-MatchMaker: 2.0.4
ChimeraX-MDcrds: 2.6
ChimeraX-MedicalToolbar: 1.0.1
ChimeraX-Meeting: 1.0
ChimeraX-MLP: 1.1
ChimeraX-mmCIF: 2.4
ChimeraX-MMTF: 2.1
ChimeraX-Modeller: 1.2.6
ChimeraX-ModelPanel: 1.2.1
ChimeraX-ModelSeries: 1.0
ChimeraX-Mol2: 2.0
ChimeraX-Morph: 1.0
ChimeraX-MouseModes: 1.1
ChimeraX-Movie: 1.0
ChimeraX-Neuron: 1.0
ChimeraX-Nucleotides: 2.0.2
ChimeraX-OpenCommand: 1.7
ChimeraX-PDB: 2.6.5
ChimeraX-PDBBio: 1.0
ChimeraX-PDBLibrary: 1.0.2
ChimeraX-PDBMatrices: 1.0
ChimeraX-PickBlobs: 1.0
ChimeraX-Positions: 1.0
ChimeraX-PresetMgr: 1.0.1
ChimeraX-PubChem: 2.1
ChimeraX-ReadPbonds: 1.0.1
ChimeraX-Registration: 1.1
ChimeraX-RemoteControl: 1.0
ChimeraX-ResidueFit: 1.0
ChimeraX-RestServer: 1.1
ChimeraX-RNALayout: 1.0
ChimeraX-RotamerLibMgr: 2.0.1
ChimeraX-RotamerLibsDunbrack: 2.0
ChimeraX-RotamerLibsDynameomics: 2.0
ChimeraX-RotamerLibsRichardson: 2.0
ChimeraX-SaveCommand: 1.5
ChimeraX-SchemeMgr: 1.0
ChimeraX-SDF: 2.0
ChimeraX-Segger: 1.0
ChimeraX-Segment: 1.0
ChimeraX-SelInspector: 1.0
ChimeraX-SeqView: 2.4.6
ChimeraX-Shape: 1.0.1
ChimeraX-Shell: 1.0
ChimeraX-Shortcuts: 1.1
ChimeraX-ShowAttr: 1.0
ChimeraX-ShowSequences: 1.0
ChimeraX-SideView: 1.0
ChimeraX-Smiles: 2.1
ChimeraX-SmoothLines: 1.0
ChimeraX-SpaceNavigator: 1.0
ChimeraX-StdCommands: 1.6.1
ChimeraX-STL: 1.0
ChimeraX-Storm: 1.0
ChimeraX-Struts: 1.0
ChimeraX-Surface: 1.0
ChimeraX-SwapAA: 2.0
ChimeraX-SwapRes: 2.1
ChimeraX-TapeMeasure: 1.0
ChimeraX-Test: 1.0
ChimeraX-Toolbar: 1.1
ChimeraX-ToolshedUtils: 1.2
ChimeraX-Tug: 1.0
ChimeraX-UI: 1.13.7
ChimeraX-uniprot: 2.2
ChimeraX-UnitCell: 1.0
ChimeraX-ViewDockX: 1.0.1
ChimeraX-VIPERdb: 1.0
ChimeraX-Vive: 1.1
ChimeraX-VolumeMenu: 1.0
ChimeraX-VTK: 1.0
ChimeraX-WavefrontOBJ: 1.0
ChimeraX-WebCam: 1.0
ChimeraX-WebServices: 1.0
ChimeraX-Zone: 1.0
colorama: 0.4.4
cxservices: 1.1
cycler: 0.11.0
Cython: 0.29.24
decorator: 5.1.0
docutils: 0.17.1
filelock: 3.0.12
funcparserlib: 0.3.6
grako: 3.16.5
h5py: 3.6.0
html2text: 2020.1.16
idna: 3.3
ihm: 0.21
imagecodecs: 2021.4.28
imagesize: 1.3.0
ipykernel: 5.5.5
ipython: 7.23.1
ipython-genutils: 0.2.0
jedi: 0.18.0
Jinja2: 3.0.1
jupyter-client: 6.1.12
jupyter-core: 4.9.1
kiwisolver: 1.3.2
lxml: 4.6.3
lz4: 3.1.3
MarkupSafe: 2.0.1
matplotlib: 3.4.3
matplotlib-inline: 0.1.3
msgpack: 1.0.2
netCDF4: 1.5.7
networkx: 2.6.3
numexpr: 2.8.0
numpy: 1.21.2
openvr: 1.16.801
packaging: 21.0
ParmEd: 3.2.0
parso: 0.8.3
pexpect: 4.8.0
pickleshare: 0.7.5
Pillow: 8.3.2
pip: 21.2.4
pkginfo: 1.7.1
prompt-toolkit: 3.0.23
psutil: 5.8.0
ptyprocess: 0.7.0
pycollada: 0.7.1
pydicom: 2.1.2
Pygments: 2.10.0
PyOpenGL: 3.1.5
PyOpenGL-accelerate: 3.1.5
pyparsing: 3.0.6
PyQt5-commercial: 5.15.2
PyQt5-sip: 12.8.1
PyQtWebEngine-commercial: 5.15.2
python-dateutil: 2.8.2
pytz: 2021.3
pyzmq: 22.3.0
qtconsole: 5.1.1
QtPy: 1.11.3
RandomWords: 0.3.0
requests: 2.26.0
scipy: 1.7.1
setuptools: 57.5.0
sfftk-rw: 0.7.1
six: 1.16.0
snowballstemmer: 2.2.0
sortedcontainers: 2.4.0
Sphinx: 4.2.0
sphinx-autodoc-typehints: 1.12.0
sphinxcontrib-applehelp: 1.0.2
sphinxcontrib-blockdiag: 2.0.0
sphinxcontrib-devhelp: 1.0.2
sphinxcontrib-htmlhelp: 2.0.0
sphinxcontrib-jsmath: 1.0.1
sphinxcontrib-qthelp: 1.0.3
sphinxcontrib-serializinghtml: 1.1.5
suds-jurko: 0.6
tifffile: 2021.4.8
tinyarray: 1.2.3
tornado: 6.1
traitlets: 5.1.1
urllib3: 1.26.7
wcwidth: 0.2.5
webcolors: 1.11.1
wheel: 0.37.0
wheel-filename: 1.3.0
Change History (2)
comment:1 by , 3 years ago
| Component: | Unassigned → Graphics |
|---|---|
| Owner: | set to |
| Platform: | → all |
| Project: | → ChimeraX |
| Status: | new → assigned |
| Summary: | ChimeraX bug report submission → glClear: invalid framebuffer operation |
comment:2 by , 3 years ago
| Resolution: | → nonchimerax |
|---|---|
| Status: | assigned → closed |
Note:
See TracTickets
for help on using tickets.
Probably related to removing a second display