Opened 3 years ago
Closed 3 years ago
#10410 closed defect (fixed)
KeyError in structure-association chain list
| Reported by: | Owned by: | Eric Pettersen | |
|---|---|---|---|
| Priority: | normal | Milestone: | |
| Component: | Sequence | Version: | |
| Keywords: | Cc: | ||
| Blocked By: | Blocking: | ||
| Notify when closed: | Platform: | all | |
| Project: | ChimeraX |
Description
The following bug report has been submitted:
Platform: macOS-14.2.1-arm64-arm-64bit
ChimeraX Version: 1.7 (2023-12-19 08:36:03 UTC)
Description
Using modeller to model missing structures
Log:
UCSF ChimeraX version: 1.7 (2023-12-19)
© 2016-2023 Regents of the University of California. All rights reserved.
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/modeling_0004.cxs
Log from Wed Dec 27 23:13:03 2023UCSF ChimeraX version: 1.7 (2023-12-19)
© 2016-2023 Regents of the University of California. All rights reserved.
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/modeling_0002.cxs
Log from Wed Dec 27 21:11:39 2023UCSF ChimeraX version: 1.7 (2023-12-19)
© 2016-2023 Regents of the University of California. All rights reserved.
How to cite UCSF ChimeraX
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/SASDB38_fit3_model1.pdb
Summary of feedback from opening /Users/derekng/Dropbox/data-
shared/business/derekng/clients/invivo-redNucleus/2023/complement-
pathway/models/c1/source/SASDB38_fit3_model1.pdb
---
warnings | Ignored bad PDB record found on line 1
REMARK File generated by Swiss-PdbViewer 4.00b0
Ignored bad PDB record found on line 2
REMARK http://www.expasy.org/spdbv/
Ignored bad PDB record found on line 22
REMARK Corresponds to Suppl Fig 4b in pubmed id 28104818
Ignored bad PDB record found on line 23
REMARK Project description: C1
Ignored bad PDB record found on line 24
REMARK j: 85 T: 0.717E-03 Suc: 91 Eva: 5926956 CPU: 0.509E+06 F:16.3033 Pen:
14.0001
2736 messages similar to the above omitted
Chain information for SASDB38_fit3_model1.pdb #1
---
Chain | Description
A E I | No description available
B F J | No description available
C G K | No description available
D H L | No description available
M | No description available
O | No description available
P | No description available
Q | No description available
R | No description available
> select /A:25-65
1284 atoms, 1296 bonds, 206 residues, 1 model selected
> select /E:25-65
1284 atoms, 1296 bonds, 206 residues, 1 model selected
> select /I:25-65
1284 atoms, 1296 bonds, 206 residues, 1 model selected
> select /B:62-91
942 atoms, 954 bonds, 148 residues, 1 model selected
> select /F:62-91
942 atoms, 954 bonds, 148 residues, 1 model selected
> select /J:62-91
942 atoms, 954 bonds, 148 residues, 1 model selected
> select /C:88-114
798 atoms, 806 bonds, 134 residues, 1 model selected
> select /G:88-114
798 atoms, 806 bonds, 134 residues, 1 model selected
> select /K:88-114
798 atoms, 806 bonds, 134 residues, 1 model selected
> select /D:1112-1245
6112 atoms, 6252 bonds, 772 residues, 1 model selected
> select /H:1112-1245
6112 atoms, 6252 bonds, 772 residues, 1 model selected
> select /L:1112-1245
6112 atoms, 6252 bonds, 772 residues, 1 model selected
> select /M:17-291
4360 atoms, 4486 bonds, 550 residues, 1 model selected
> select clear
> hide atoms
> show cartoons
> select /M:17-291
4360 atoms, 4486 bonds, 550 residues, 1 model selected
> select clear
Drag select of 1 residues
> show sel atoms
> hide sel atoms
> select clear
> select /M:17-291
4360 atoms, 4486 bonds, 550 residues, 1 model selected
> select /O:292-684
6078 atoms, 6238 bonds, 786 residues, 1 model selected
> select /M:17-291
4360 atoms, 4486 bonds, 550 residues, 1 model selected
> hide sel cartoons
> select /O:292-684
6078 atoms, 6238 bonds, 786 residues, 1 model selected
> hide sel cartoons
> select /P:22-189
2666 atoms, 2744 bonds, 336 residues, 1 model selected
> hide sel cartoons
> select /Q:190-306
1896 atoms, 1944 bonds, 234 residues, 1 model selected
> hide sel cartoons
> select /R:307-702
6326 atoms, 6490 bonds, 792 residues, 1 model selected
> hide sel cartoons
> color sel white
> select clear
> color white
> select clear
Drag select of 6 residues
> select up
1308 atoms, 1320 bonds, 210 residues, 1 model selected
Drag select of 7 residues
> select up
1308 atoms, 1320 bonds, 210 residues, 1 model selected
> select clear
[Repeated 3 time(s)]Drag select of 1 residues
> select up
1308 atoms, 1320 bonds, 210 residues, 1 model selected
> ui tool show "Show Sequence Viewer"
> sequence chain /I
Alignment identifier is 1/I
> select /I:25
16 atoms, 14 bonds, 2 residues, 1 model selected
> select /I:25-29
74 atoms, 74 bonds, 10 residues, 1 model selected
> select /I:25
16 atoms, 14 bonds, 2 residues, 1 model selected
> select /I:25-47
684 atoms, 688 bonds, 110 residues, 1 model selected
> select /I:48
42 atoms, 36 bonds, 6 residues, 1 model selected
> select /I:48-54
272 atoms, 270 bonds, 42 residues, 1 model selected
> select /I:59
52 atoms, 46 bonds, 6 residues, 1 model selected
> select /I:25-59
1136 atoms, 1146 bonds, 182 residues, 1 model selected
Drag select of 2717 residues
> select up
22068 atoms, 22542 bonds, 2910 residues, 1 model selected
> select up
49238 atoms, 50348 bonds, 6538 residues, 1 model selected
> select down
22068 atoms, 22542 bonds, 2910 residues, 1 model selected
Drag select of 407 residues
> select up
3971 atoms, 4054 bonds, 533 residues, 1 model selected
> select up
3993 atoms, 4077 bonds, 536 residues, 1 model selected
> select up
7036 atoms, 7190 bonds, 920 residues, 1 model selected
> select up
49238 atoms, 50348 bonds, 6538 residues, 1 model selected
> select down
7036 atoms, 7190 bonds, 920 residues, 1 model selected
> select clear
[Repeated 1 time(s)]Drag select of 3 residues
> select up
1308 atoms, 1320 bonds, 210 residues, 1 model selected
> select /I:33,59
102 atoms, 92 bonds, 12 residues, 1 model selected
> select /I:33,33,34-59
1000 atoms, 1008 bonds, 162 residues, 1 model selected
> select /I:59
52 atoms, 46 bonds, 6 residues, 1 model selected
> select /I:25-59
1136 atoms, 1146 bonds, 182 residues, 1 model selected
> select clear
Drag select of 2 residues
> select up
1308 atoms, 1320 bonds, 210 residues, 1 model selected
> select clear
> help help:user
> sequence align #1/I,P02747
Must specify 2 or more protein sequences
Fetching compressed P02747 UniProt info from
https://www.uniprot.org/uniprot/P02747.xml
> sequence align P02747,#1/I
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain I with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: ZVHKXLBNQQLG2NAU
> select /A,E,I:31
48 atoms, 36 bonds, 12 residues, 1 model selected
> select /A,E,I:31-65
3582 atoms, 3612 bonds, 582 residues, 1 model selected
> select clear
> sequence associate /I 1:1
Disassociated SASDB38_fit3_model1.pdb chain I from chain I
Associated SASDB38_fit3_model1.pdb chain I to P02747 with 145 mismatches
and/or gaps
> select /I:31
16 atoms, 12 bonds, 4 residues, 1 model selected
> select /I:31-65
1194 atoms, 1204 bonds, 194 residues, 1 model selected
> select /I:31
16 atoms, 12 bonds, 4 residues, 1 model selected
> select /I:31-32
46 atoms, 42 bonds, 8 residues, 1 model selected
> select /I:31
16 atoms, 12 bonds, 4 residues, 1 model selected
> select /I:31-36
196 atoms, 194 bonds, 32 residues, 1 model selected
> select #1/I:75-100
Nothing selected
> sequence associate /I 1:2
Disassociated SASDB38_fit3_model1.pdb chain I from P02747
Associated SASDB38_fit3_model1.pdb chain I to chain I with 0 mismatches
> select #1/I:75-100
Nothing selected
> select #1/I:75-100
Nothing selected
> select #1/I:75
Nothing selected
> select #1/I:
Expected an objects specifier or a keyword
> select #1/I:1
Nothing selected
> select #1/I
1308 atoms, 1320 bonds, 210 residues, 1 model selected
> select #1/I:28
10 atoms, 8 bonds, 2 residues, 1 model selected
> select #1/I:28-29
24 atoms, 24 bonds, 4 residues, 1 model selected
> select /I:67
16 atoms, 14 bonds, 2 residues, 1 model selected
> select
> /I:25-33,33,34,34,35,35,36,36,37,37,38,38,39,39,40,40,41,41,42,42,43,43,44,44,45,45,46,46,47,47,48,48,49,49,50,50,51,51,52,52,53,53,54,54,55,55,56,56,57,57,58,58,59,59-67
1308 atoms, 1320 bonds, 210 residues, 1 model selected
> select /I:25
16 atoms, 14 bonds, 2 residues, 1 model selected
> select
> /I:25-33,33,34,34,35,35,36,36,37,37,38,38,39,39,40,40,41,41,42,42,43,43,44,44,45,45,46,46,47,47,48,48,49,49,50,50,51,51,52,52,53,53,54,54,55,55,56,56,57-59
1136 atoms, 1146 bonds, 182 residues, 1 model selected
> select /I:25
16 atoms, 14 bonds, 2 residues, 1 model selected
> select /I:25-29
74 atoms, 74 bonds, 10 residues, 1 model selected
> select /I:25
16 atoms, 14 bonds, 2 residues, 1 model selected
> select /I:25-42
504 atoms, 504 bonds, 80 residues, 1 model selected
> select /I:25
16 atoms, 14 bonds, 2 residues, 1 model selected
> select /I:25-35
258 atoms, 258 bonds, 38 residues, 1 model selected
> select /I:41
46 atoms, 40 bonds, 6 residues, 1 model selected
> select /I:41-44
162 atoms, 158 bonds, 24 residues, 1 model selected
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/c1q_1.pdb
Chain information for c1q_1.pdb #2
---
Chain | Description
A | No description available
Associated c1q_1.pdb chain A to chain I with 0 mismatches
> hide #2 models
> show #2 models
> close #2
> close #1
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/SASDB38_fit3_model1.pdb
Summary of feedback from opening /Users/derekng/Dropbox/data-
shared/business/derekng/clients/invivo-redNucleus/2023/complement-
pathway/models/c1/source/SASDB38_fit3_model1.pdb
---
warnings | Ignored bad PDB record found on line 1
REMARK File generated by Swiss-PdbViewer 4.00b0
Ignored bad PDB record found on line 2
REMARK http://www.expasy.org/spdbv/
Ignored bad PDB record found on line 22
REMARK Corresponds to Suppl Fig 4b in pubmed id 28104818
Ignored bad PDB record found on line 23
REMARK Project description: C1
Ignored bad PDB record found on line 24
REMARK j: 85 T: 0.717E-03 Suc: 91 Eva: 5926956 CPU: 0.509E+06 F:16.3033 Pen:
14.0001
2736 messages similar to the above omitted
Chain information for SASDB38_fit3_model1.pdb #1
---
Chain | Description
A E I | No description available
B F J | No description available
C G K | No description available
D H L | No description available
M | No description available
O | No description available
P | No description available
Q | No description available
R | No description available
Associated SASDB38_fit3_model1.pdb chain A to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain I with 0 mismatches
> hide atoms
> show cartoons
> color white
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/modeling_0001.cxs
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/1.pdb
Chain information for 1.pdb #2
---
Chain | Description
A | No description available
Associated 1.pdb chain A to chain I with 0 mismatches
> ui tool show "Show Sequence Viewer"
> sequence chain #2/A
Alignment identifier is 2/A
Fetching compressed P02745 UniProt info from
https://www.uniprot.org/uniprot/P02745.xml
> sequence align P02745,#2/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain A with 0 mismatches
Associated 1.pdb chain A to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: ZHIM3ZD679W971AV
> rename #2 "c1q_A (n-term).pdb"
> select add #2
234 atoms, 234 bonds, 35 residues, 1 model selected
> select clear
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/grouped/c1q_A_n_term.pdb models #2 relModel #1
> close #2
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/grouped/c1q_A_n_term.pdb
Chain information for c1q_A_n_term.pdb #2
---
Chain | Description
A | No description available
Associated c1q_A_n_term.pdb chain A to P02745 with 0 mismatches
> close #2
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/2.pdb
Chain information for 2.pdb #2
---
Chain | Description
A | No description available
> ui tool show "Show Sequence Viewer"
> sequence align P02745,#2/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain A with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain A with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain A with 15 mismatches
Associated 2.pdb chain A to chain A with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: AGY02F5B94T9R7WC
Fetching compressed P02746 UniProt info from
https://www.uniprot.org/uniprot/P02746.xml
> sequence align P02746,#2/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain A with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain A with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain A with 15 mismatches
Associated 2.pdb chain A to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: M717PX1X8W9T1DNY
> sequence align P02747,#2/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain A with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain A with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain A with 15 mismatches
Associated 2.pdb chain A to chain A with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: C751SE1M4IBIRM98
> sequence align P02745,#2/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain A with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain A with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain A with 15 mismatches
Associated 2.pdb chain A to chain A with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 4KUB2VE0BC4RJQ1M
> sequence align P02746,#2/A
Alignment identifier is 2
Associated SASDB38_fit3_model1.pdb chain A to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain A with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain A with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain A with 15 mismatches
Associated 2.pdb chain A to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 2
Webservices job id: PEEVN351KOLVV4I3
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/grouped/c1q_B_n_term.pdb models #2 relModel #1
> close #2
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/3.pdb
Chain information for 3.pdb #2
---
Chain | Description
A | No description available
> sequence align P02746,#2/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain A with 0 mismatches
Associated 3.pdb chain A to chain A with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: GUN56JDWRZWZD51P
> sequence align P02747,#2/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain A with 0 mismatches
Associated 3.pdb chain A to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: DT0E93XLMO2DVEBB
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/grouped/c1q_C_n_term.pdb models #2 relModel #1
> close #2
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/4.pdb
Chain information for 4.pdb #2
---
Chain | Description
B | No description available
> ui tool show "Show Sequence Viewer"
> sequence chain #2/B
Alignment identifier is 2/B
> select #2/B:62
4 atoms, 3 bonds, 1 residue, 1 model selected
> select #2/B:62-65
25 atoms, 24 bonds, 4 residues, 1 model selected
> select #2/B:62
4 atoms, 3 bonds, 1 residue, 1 model selected
> select #2/B:62-77
247 atoms, 248 bonds, 36 residues, 1 model selected
> close #2
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/4_a.pdb
Chain information for 4_a.pdb #2
---
Chain | Description
B | No description available
> sequence align P02745,#2/B
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain B with 0 mismatches
Associated 4_a.pdb chain B to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: W7YIMCKC67K4DS50
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/grouped/c1q_A_collagen_pre.pdb models #2
> relModel #1
> close #2
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/4_b.pdb
Chain information for 4_b.pdb #2
---
Chain | Description
B | No description available
> sequence align P02746,#2/B
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain B with 11 mismatches
Associated 4_b.pdb chain B to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: HECPDU4T0LVOCM4W
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/grouped/c1q_B_collagen_pre.pdb models #2
> relModel #1
> close #2
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/4_c.pdb
Chain information for 4_c.pdb #2
---
Chain | Description
B | No description available
> sequence align P02747,#2/B
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain B with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain B with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain B with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain B with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain B with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain B with 10 mismatches
Associated 4_c.pdb chain B to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: T4VAJ4E7CLHZVX3S
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/grouped/c1q_C_collagen_pre.pdb models #2
> relModel #1
> close #2
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/5.pdb
Chain information for 5.pdb #2
---
Chain | Description
C | No description available
> sequence align P02745,#2/C
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain C with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain C with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain C with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain C with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain C with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain C with 0 mismatches
Associated 5.pdb chain C to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: J14Z1ZQ7X7OI7YPO
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/grouped/c1q_A_collagen_post.pdb models #2
> relModel #1
> close #2
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/6.pdb
Chain information for 6.pdb #2
---
Chain | Description
C | No description available
> sequence align P02746,#2/C
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain C with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain C with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain C with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain C with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain C with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain C with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain C with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain C with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain C with 0 mismatches
Associated 6.pdb chain C to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: X70H5VIGGMFJL1RI
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/grouped/c1q_B_collagen_post.pdb models #2
> relModel #1
> close #2
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/7.pdb
Chain information for 7.pdb #2
---
Chain | Description
C | No description available
> sequence align P02747,#2/C
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain C with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain C with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain C with 0 mismatches
Associated 7.pdb chain C to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: DNXPX5JASAEBB6PA
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/grouped/c1q_C_collagen_post.pdb models #2
> relModel #1
> close #2
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/8.pdb
Chain information for 8.pdb #2
---
Chain | Description
D | No description available
> sequence align P02745,#2/D
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated 8.pdb chain D to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: XRD6RL3N631SRGLK
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/grouped/c1q_A_collagen_c_term.pdb models #2
> relModel #1
> close #2
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/9.pdb
Chain information for 9.pdb #2
---
Chain | Description
D | No description available
> sequence align P02746,#2/D
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain D with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain D with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain D with 0 mismatches
Associated 9.pdb chain D to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 1G4GTA4S09OGONEL
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/grouped/c1q_B_collagen_c_term.pdb models #2
> relModel #1
> close #2
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/10.pdb
Chain information for 10.pdb #2
---
Chain | Description
D | No description available
> sequence align P02747,#2/D
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain D with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain D with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain D with 0 mismatches
Associated 10.pdb chain D to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 4UJEPI9UPEGINRT0
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/grouped/c1q_C_collagen_c_term.pdb models #2
> relModel #1
> close #2
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_A_n_term.pdb
Chain information for c1q_A_n_term.pdb #2
---
Chain | Description
A | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_A_collagen_pre.pdb
Chain information for c1q_A_collagen_pre.pdb #3
---
Chain | Description
B | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_A_collagen_post.pdb
Chain information for c1q_A_collagen_post.pdb #4
---
Chain | Description
C | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_A_collagen_c_term.pdb
Chain information for c1q_A_collagen_c_term.pdb #5
---
Chain | Description
D | No description available
> ui tool show "Change Chain IDs"
> select add #2
234 atoms, 234 bonds, 35 residues, 1 model selected
> select add #3
398 atoms, 400 bonds, 61 residues, 2 models selected
> select subtract #2
164 atoms, 166 bonds, 26 residues, 1 model selected
> changechains sel A
Chain IDs of 26 residues changed
> select subtract #3
Nothing selected
> select add #4
136 atoms, 136 bonds, 22 residues, 1 model selected
> changechains sel A
Chain IDs of 22 residues changed
> select subtract #4
Nothing selected
> select add #5
1036 atoms, 1060 bonds, 130 residues, 1 model selected
> changechains sel A
Chain IDs of 130 residues changed
> select subtract #5
Nothing selected
> combine #2,#3,#4,#5
Expected a keyword
> combine #2,3,4,5
Remapping chain ID 'A' in c1q_A_collagen_pre.pdb #3 to 'B'
Remapping chain ID 'A' in c1q_A_collagen_post.pdb #4 to 'C'
Remapping chain ID 'A' in c1q_A_collagen_c_term.pdb #5 to 'D'
> hide #5 models
> hide #4 models
> hide #3 models
> hide #2 models
> hide #!1 models
> select add #6
1570 atoms, 1596 bonds, 213 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel A
Chain IDs of 178 residues changed
> select clear
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/modeling_0002.cxs
——— End of log from Wed Dec 27 21:11:39 2023 ———
opened ChimeraX session
> close #2-6
> open /Users/derekng/Downloads/model_01.pdb
model_01.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for model_01.pdb #2
---
Chain | Description
A | No description available
> sequence align P02745,#2/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated model_01.pdb chain A to chain A with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 0QHHC94FPAH614VQ
> select #2/A:1
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #2/A:1-5
37 atoms, 37 bonds, 5 residues, 1 model selected
> sequence associate #2/A 1:1
Disassociated model_01.pdb chain A from chain A
Associated model_01.pdb chain A to P02745 with 0 mismatches
> select #2/A:1
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #2/A:1-11
80 atoms, 80 bonds, 11 residues, 1 model selected
> show #!1 models
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_A_A_swissmodel.pdb
c1q_A_A_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_A_A_swissmodel.pdb #3
---
Chain | Description
A | No description available
Associated c1q_A_A_swissmodel.pdb chain A to chain A with 0 mismatches
> select add #2
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> select subtract #2
Nothing selected
> select add #3
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel B
Chain IDs of 220 residues changed
Drag select of 188 residues
> select clear
> select #1/H:1198
52 atoms, 48 bonds, 6 residues, 1 model selected
> select up
340 atoms, 340 bonds, 44 residues, 1 model selected
> select clear
Drag select of 382 residues
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/modeling_0003.cxs
> ui tool show Matchmaker
> matchmaker #3 to #1 & sel
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker SASDB38_fit3_model1.pdb, chain H (#1) with c1q_A_A_swissmodel.pdb,
chain B (#3), sequence alignment score = 624.4
RMSD between 128 pruned atom pairs is 0.076 angstroms; (across all 128 pairs:
0.076)
> select clear
[Repeated 1 time(s)]Drag select of 3 residues
> select up
68 atoms, 68 bonds, 10 residues, 1 model selected
> select up
1010 atoms, 1037 bonds, 129 residues, 1 model selected
> matchmaker #3 to #1 & sel
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker SASDB38_fit3_model1.pdb, chain H (#1) with c1q_A_A_swissmodel.pdb,
chain B (#3), sequence alignment score = 294.2
RMSD between 104 pruned atom pairs is 0.686 angstroms; (across all 126 pairs:
2.575)
> close #3
> select clear
> hide #!1 models
> rename #2 c1q_A_chainA
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/modeling_0003.cxs
> show #!1 models
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainA/c1q_B_n_term.pdb
Chain information for c1q_B_n_term.pdb #3
---
Chain | Description
A | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainA/c1q_B_collagen_pre.pdb
Chain information for c1q_B_collagen_pre.pdb #4
---
Chain | Description
B | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainA/c1q_B_collagen_post.pdb
Chain information for c1q_B_collagen_post.pdb #5
---
Chain | Description
C | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainA/c1q_B_collagen_c_term.pdb
Chain information for c1q_B_collagen_c_term.pdb #6
---
Chain | Description
D | No description available
> hide #!1 models
> hide #2 models
> combine #3,4,5,6
> close #3-6
> select add #7
1556 atoms, 1585 bonds, 215 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel A
Chain IDs of 180 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/processed/02/c1q_B_chainA.pdb
> models #7 relModel #1
> hide #7 models
> show #2 models
> select subtract #7
Nothing selected
> select ::name="HYP"
888 atoms, 666 bonds, 222 residues, 2 models selected
> select add #7
2396 atoms, 2215 bonds, 425 residues, 2 models selected
> show #7 models
> select subtract #7
840 atoms, 630 bonds, 210 residues, 1 model selected
> select add #1
49238 atoms, 50348 bonds, 6538 residues, 1 model selected
> select subtract #1
Nothing selected
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_B_chainA_swissmodel.pdb
c1q_B_chainA_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_B_chainA_swissmodel.pdb #3
---
Chain | Description
A | No description available
> hide #7 models
> show #7 models
> hide #7 models
> show #7 models
> hide #7 models
> sequence align P02746,#3/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain A with 54 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain A with 54 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain A with 54 mismatches
Associated combination chain A to P02746 with 0 mismatches
[Repeated 1 time(s)]Associated combination chain A to chain A with 0
mismatches
[Repeated 1 time(s)]Associated c1q_B_chainA_swissmodel.pdb chain A to P02746
with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: X6TLX4JG82AXMB11
> select clear
> select #1/D,H,L:1119-1121
396 atoms, 378 bonds, 48 residues, 1 model selected
> select #1/D,H,L:1123
120 atoms, 102 bonds, 18 residues, 1 model selected
> select #1/D,H,L:1123-1127
654 atoms, 654 bonds, 90 residues, 1 model selected
> sequence disassociate #7/A
Disassociated combination chain A from P02746
Disassociated combination chain A from chain A
[Repeated 1 time(s)]Disassociated combination chain A from P02746
> sequence disassociate #1/D
Disassociated SASDB38_fit3_model1.pdb chain D from chain A
> sequence disassociate #1/H
Disassociated SASDB38_fit3_model1.pdb chain H from chain A
> sequence disassociate #1/L
Disassociated SASDB38_fit3_model1.pdb chain L from chain A
> select #3/A:32
9 atoms, 8 bonds, 1 residue, 1 model selected
> select #3/A:32-38
50 atoms, 50 bonds, 7 residues, 1 model selected
> show #7 models
> hide #7 models
> show #7 models
> close #3
> select clear
[Repeated 3 time(s)]
> ui tool show "Show Sequence Viewer"
> close #7
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/processed/02/c1q_B_chainA.pdb
Summary of feedback from opening /Users/derekng/Dropbox/data-
shared/business/derekng/clients/invivo-redNucleus/2023/complement-
pathway/models/c1/processed/02/c1q_B_chainA.pdb
---
warning | PDB SEQRES record for chain A is incomplete. Ignoring input sequence
records as basis for sequence.
Chain information for c1q_B_chainA.pdb #3
---
Chain | Description
A | No description available
> hide #2 models
> ui tool show "Show Sequence Viewer"
> sequence chain #3/A
Alignment identifier is 3/A
> sequence align P02746,#3/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain A with 74 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain A with 74 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain A with 74 mismatches
Associated c1q_B_chainA.pdb chain A to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: HXL707BKY1Z843Z0
> select #1/D,H,L:1163
162 atoms, 156 bonds, 18 residues, 1 model selected
> select #1/D,H,L:1163-1165
414 atoms, 414 bonds, 54 residues, 1 model selected
> select add #1
49238 atoms, 50348 bonds, 6538 residues, 1 model selected
> select subtract #1
Nothing selected
> select ::name="HYP"
888 atoms, 666 bonds, 222 residues, 2 models selected
> select intersect #3/A
48 atoms, 36 bonds, 12 residues, 1 model selected
> ui tool show Rotamers
> swapaa interactive sel PRO rotLib Dunbrack
c1q_B_chainA.pdb #3/A HYP 35: phi -68.5, psi 151.6 trans
Changed 10 bond radii
c1q_B_chainA.pdb #!3/A HYP 38: phi -68.5, psi 151.6 trans
Changed 10 bond radii
c1q_B_chainA.pdb #!3/A HYP 41: phi -64.6, psi 151.5 trans
Changed 10 bond radii
c1q_B_chainA.pdb #!3/A HYP 53: phi -59.3, psi 151.6 trans
Changed 10 bond radii
c1q_B_chainA.pdb #!3/A HYP 56: phi -59.2, psi 151.6 trans
Changed 10 bond radii
c1q_B_chainA.pdb #!3/A HYP 65: phi -59.0, psi 151.4 trans
Changed 10 bond radii
c1q_B_chainA.pdb #!3/A HYP 80: phi -59.0, psi 151.5 trans
Changed 10 bond radii
c1q_B_chainA.pdb #!3/A HYP 83: phi -58.9, psi 151.5 trans
Changed 10 bond radii
c1q_B_chainA.pdb #!3/A HYP 86: phi -59.0, psi 151.5 trans
Changed 10 bond radii
c1q_B_chainA.pdb #!3/A HYP 101: phi -59.1, psi 151.5 trans
Changed 10 bond radii
c1q_B_chainA.pdb #!3/A HYP 104: phi -59.1, psi 151.6 trans
Changed 10 bond radii
c1q_B_chainA.pdb #!3/A HYP 107: phi -59.0, psi 151.8 trans
Changed 10 bond radii
> swapaa #!3/A:107 PRO criteria 1 rotLib Dunbrack
Using Dunbrack library
c1q_B_chainA.pdb #!3/A HYP 107: phi -59.0, psi 151.8 trans
Applying PRO rotamer (chi angles: -23.7 35.2) to c1q_B_chainA.pdb #!3/A PRO
107
> swapaa #!3/A:104 PRO criteria 1 rotLib Dunbrack
Using Dunbrack library
c1q_B_chainA.pdb #!3/A HYP 104: phi -59.1, psi 151.6 trans
Applying PRO rotamer (chi angles: -23.7 35.2) to c1q_B_chainA.pdb #!3/A PRO
104
> swapaa #!3/A:35 PRO criteria 1 rotLib Dunbrack
Using Dunbrack library
c1q_B_chainA.pdb #!3/A HYP 35: phi -68.5, psi 151.6 trans
Applying PRO rotamer (chi angles: 26.3 -34.2) to c1q_B_chainA.pdb #!3/A PRO 35
> swapaa #!3/A:56 PRO criteria 1 rotLib Dunbrack
Using Dunbrack library
c1q_B_chainA.pdb #!3/A HYP 56: phi -59.2, psi 151.6 trans
Applying PRO rotamer (chi angles: -23.7 35.2) to c1q_B_chainA.pdb #!3/A PRO 56
> swapaa #!3/A:65 PRO criteria 1 rotLib Dunbrack
Using Dunbrack library
c1q_B_chainA.pdb #!3/A HYP 65: phi -59.0, psi 151.4 trans
Applying PRO rotamer (chi angles: -23.7 35.2) to c1q_B_chainA.pdb #!3/A PRO 65
> swapaa #!3/A:80 PRO criteria 1 rotLib Dunbrack
Using Dunbrack library
c1q_B_chainA.pdb #!3/A HYP 80: phi -59.0, psi 151.5 trans
Applying PRO rotamer (chi angles: -23.7 35.2) to c1q_B_chainA.pdb #!3/A PRO 80
> swapaa #!3/A:53 PRO criteria 1 rotLib Dunbrack
Using Dunbrack library
c1q_B_chainA.pdb #!3/A HYP 53: phi -59.3, psi 151.6 trans
Applying PRO rotamer (chi angles: -23.7 35.2) to c1q_B_chainA.pdb #!3/A PRO 53
> swapaa #!3/A:83 PRO criteria 1 rotLib Dunbrack
Using Dunbrack library
c1q_B_chainA.pdb #!3/A HYP 83: phi -58.9, psi 151.5 trans
Applying PRO rotamer (chi angles: -23.7 35.2) to c1q_B_chainA.pdb #!3/A PRO 83
> swapaa #!3/A:41 PRO criteria 1 rotLib Dunbrack
Using Dunbrack library
c1q_B_chainA.pdb #!3/A HYP 41: phi -64.6, psi 151.5 trans
Applying PRO rotamer (chi angles: -23.7 35.2) to c1q_B_chainA.pdb #!3/A PRO 41
> swapaa #!3/A:86 PRO criteria 1 rotLib Dunbrack
Using Dunbrack library
c1q_B_chainA.pdb #!3/A HYP 86: phi -59.0, psi 151.5 trans
Applying PRO rotamer (chi angles: -23.7 35.2) to c1q_B_chainA.pdb #!3/A PRO 86
> swapaa #!3/A:38 PRO criteria 1 rotLib Dunbrack
Using Dunbrack library
c1q_B_chainA.pdb #!3/A HYP 38: phi -68.5, psi 151.6 trans
Applying PRO rotamer (chi angles: 26.3 -34.2) to c1q_B_chainA.pdb #!3/A PRO 38
> swapaa #!3/A:101 PRO criteria 1 rotLib Dunbrack
Using Dunbrack library
c1q_B_chainA.pdb #!3/A HYP 101: phi -59.1, psi 151.5 trans
Applying PRO rotamer (chi angles: -23.7 35.2) to c1q_B_chainA.pdb #!3/A PRO
101
> select add #3
1592 atoms, 1633 bonds, 215 residues, 1 model selected
> select subtract #3
Nothing selected
> select ::name="HYP"
840 atoms, 630 bonds, 210 residues, 1 model selected
> select add #1
49238 atoms, 50348 bonds, 6538 residues, 1 model selected
> select subtract #1
Nothing selected
> sequence align P02746,#3/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain A with 74 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain A with 74 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain A with 74 mismatches
Associated c1q_B_chainA.pdb chain A to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 13X76KX0WXQO63FQ
> sequence disassociate #1/D
Disassociated SASDB38_fit3_model1.pdb chain D from chain A
> sequence disassociate #1/H
Disassociated SASDB38_fit3_model1.pdb chain H from chain A
> sequence disassociate #1/L
Disassociated SASDB38_fit3_model1.pdb chain L from chain A
> sequence disassociate #3/A
Disassociated c1q_B_chainA.pdb chain A from P02746
> sequence associate #3/A 1:1
Associated c1q_B_chainA.pdb chain A to P02746 with 0 mismatches
> select clear
[Repeated 1 time(s)]
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/processed/02/c1q_B_chainA.pdb
> models #3 relModel #1
> select add #3
1592 atoms, 1633 bonds, 215 residues, 1 model selected
> ui tool show "Renumber Residues"
> renumber #3/A seqStart 33
0 residues renumbered
> renumber #3/A seqStart 33
0 residues renumbered
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_B_chainA_renumbered.pdb models #3
> relModel #1
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/modeling_0004.cxs
——— End of log from Wed Dec 27 23:13:03 2023 ———
opened ChimeraX session
> rename #2 c1q_A_chainA_swissmodel
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_B_chainA_swissmodel.pdb
c1q_B_chainA_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_B_chainA_swissmodel.pdb #4
---
Chain | Description
A | No description available
> select subtract #3
Nothing selected
> hide #3 models
> show #3 models
> hide #3 models
> show #3 models
> sequence align #3/A,#4/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain A with 54 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain A with 54 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain A with 54 mismatches
Associated c1q_B_chainA.pdb chain A to chain A with 0 mismatches
Associated c1q_B_chainA_swissmodel.pdb chain A to chain A with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: OLYOTC8W9O7UXTFC
> select clear
[Repeated 1 time(s)]
> sequence disassociate #1/D
Disassociated SASDB38_fit3_model1.pdb chain D from chain A
> sequence disassociate #1/H
Disassociated SASDB38_fit3_model1.pdb chain H from chain A
> sequence disassociate #1/L
Disassociated SASDB38_fit3_model1.pdb chain L from chain A
> sequence disassociate #3/A
Disassociated c1q_B_chainA.pdb chain A from chain A
> sequence disassociate #4/A
Disassociated c1q_B_chainA_swissmodel.pdb chain A from chain A
> sequence associate #2/A
Associated c1q_A_chainA_swissmodel chain A to chain A with 110 mismatches
and/or gaps
> sequence disassociate #2/A
Disassociated c1q_A_chainA_swissmodel chain A from chain A
> sequence associate #3/A 1:2
Associated c1q_B_chainA.pdb chain A to chain A with 0 mismatches
> sequence associate #4/A 1:2
Associated c1q_B_chainA_swissmodel.pdb chain A to chain A with 0 mismatches
> select clear
[Repeated 7 time(s)]
> select #4/A:33
4 atoms, 3 bonds, 1 residue, 1 model selected
> select #4/A:33-37
34 atoms, 33 bonds, 5 residues, 1 model selected
> select #4/A:53
7 atoms, 7 bonds, 1 residue, 1 model selected
> select #3/A:1119 #4/A:53-92
262 atoms, 271 bonds, 41 residues, 2 models selected
Clustal Omega Alignment [ID: 1] region chain A [48-87] RMSD: 0.252
> select clear
[Repeated 6 time(s)]
> select #4/A:32-35
31 atoms, 30 bonds, 4 residues, 1 model selected
> select #4/A:32-37
43 atoms, 42 bonds, 6 residues, 1 model selected
> select clear
[Repeated 3 time(s)]
> ui tool show "Show Sequence Viewer"
> sequence chain #3/A
Alignment identifier is 3/A
> select #3/A:58
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #3/A:33-58
163 atoms, 171 bonds, 26 residues, 1 model selected
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/processed/02/temp.pdb models #3
> selectedOnly true relModel #1
> hide #3 models
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/processed/02/temp.pdb
Summary of feedback from opening /Users/derekng/Dropbox/data-
shared/business/derekng/clients/invivo-redNucleus/2023/complement-
pathway/models/c1/processed/02/temp.pdb
---
warnings | Start residue of secondary structure not found: SHEET 1 1 1 ALA
A1123 THR A1127 0
Start residue of secondary structure not found: SHEET 2 2 1 HIS A1144 MET
A1149 0
Start residue of secondary structure not found: SHEET 3 3 1 LYS A1159 THR
A1161 0
Start residue of secondary structure not found: SHEET 4 4 1 GLY A1166 SER
A1176 0
Start residue of secondary structure not found: SHEET 5 5 1 LEU A1180 GLY
A1187 0
4 messages similar to the above omitted
Chain information for temp.pdb #5
---
Chain | Description
A | No description available
Associated temp.pdb chain A to chain A with 0 mismatches
> ui tool show "Show Sequence Viewer"
> sequence chain #5/A
Alignment identifier is 5/A
> sequence chain #4/A
Alignment identifier is 4/A
> select #5/A:58
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #5/A:58
8 atoms, 7 bonds, 1 residue, 1 model selected
> hide sel cartoons
> show sel atoms
> style sel ball
Changed 8 atom styles
> color sel byelement
> select #4/A:32
9 atoms, 8 bonds, 1 residue, 1 model selected
> select #4/A:32
9 atoms, 8 bonds, 1 residue, 1 model selected
> hide sel cartoons
> show sel atoms
> style sel ball
Changed 9 atom styles
> color sel byelement
> select #5/A:58
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #5/A:58
8 atoms, 7 bonds, 1 residue, 1 model selected
> select clear
[Repeated 1 time(s)]
> select #4/A:32
9 atoms, 8 bonds, 1 residue, 1 model selected
Drag select of 17 atoms, 4 residues, 15 bonds
> view sel
> select clear
> ui tool show "Build Structure"
> select #5/A:58@C
1 atom, 1 residue, 1 model selected
> select add #4/A:32@N
2 atoms, 2 residues, 2 models selected
> build join peptide sel length 1.33 omega 180 phi -120 move C
> select add #4
1611 atoms, 1655 bonds, 218 residues, 1 model selected
> select clear
> view
> show #3 models
> select add #4
1611 atoms, 1655 bonds, 218 residues, 1 model selected
> select subtract #4
Nothing selected
> hide #3 models
> show #3 models
> select #4/A:47
7 atoms, 7 bonds, 1 residue, 1 model selected
> select up
591 atoms, 613 bonds, 90 residues, 1 model selected
> select down
7 atoms, 7 bonds, 1 residue, 1 model selected
> select add #4
1611 atoms, 1655 bonds, 218 residues, 1 model selected
> select clear
> ui tool show "Show Sequence Viewer"
> sequence chain #4/A
Alignment identifier is 4/A
> select #4/A:58
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #4/A:33-58
163 atoms, 171 bonds, 26 residues, 1 model selected
> select clear
[Repeated 1 time(s)]
> sequence associate #2/A
Associated c1q_A_chainA_swissmodel chain A to chain A with 136 mismatches
and/or gaps
> sequence disassociate #4/A
Disassociated c1q_B_chainA_swissmodel.pdb chain A from chain A
> sequence disassociate #2/A
Disassociated c1q_A_chainA_swissmodel chain A from chain A
> sequence associate #3/A
Associated c1q_B_chainA.pdb chain A to chain A with 0 mismatches
> sequence disassociate #3/A
Disassociated c1q_B_chainA.pdb chain A from chain A
> sequence associate #4/A
Associated c1q_B_chainA_swissmodel.pdb chain A to chain A with 0 mismatches
> sequence associate #3/A
Associated c1q_B_chainA.pdb chain A to chain A with 0 mismatches
> sequence disassociate #4/A
Disassociated c1q_B_chainA_swissmodel.pdb chain A from chain A
> sequence associate #2/A
Associated c1q_A_chainA_swissmodel chain A to chain A with 136 mismatches
and/or gaps
> sequence disassociate #3/A
Disassociated c1q_B_chainA.pdb chain A from chain A
> sequence associate #1/R
Associated SASDB38_fit3_model1.pdb chain R to chain A with 422 mismatches
and/or gaps
> sequence disassociate #2/A
Disassociated c1q_A_chainA_swissmodel chain A from chain A
> sequence disassociate #1/R
Disassociated SASDB38_fit3_model1.pdb chain R from chain A
> sequence associate #4/A
Associated c1q_B_chainA_swissmodel.pdb chain A to chain A with 0 mismatches
> select #4/A:58
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #4/A:33-58
163 atoms, 171 bonds, 26 residues, 1 model selected
> sequence align
> QLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA,#4/A
Alignment identifier is 1
Associated c1q_B_chainA.pdb chain A to chain A with 0 mismatches
Associated c1q_B_chainA_swissmodel.pdb chain A to chain A with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 63JIIQG9ZBFMHOU1
> select clear
[Repeated 3 time(s)]
> select #4/A:104-105
20 atoms, 20 bonds, 2 residues, 1 model selected
> select #4/A:104-111
61 atoms, 62 bonds, 8 residues, 1 model selected
> select #4/A:91
4 atoms, 3 bonds, 1 residue, 1 model selected
> select #4/A:91-112
149 atoms, 152 bonds, 22 residues, 1 model selected
> select clear
> select #4/A:90
9 atoms, 8 bonds, 1 residue, 1 model selected
> select clear
[Repeated 1 time(s)]
> close #4
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/processed/02/temp.pdb
Summary of feedback from opening /Users/derekng/Dropbox/data-
shared/business/derekng/clients/invivo-redNucleus/2023/complement-
pathway/models/c1/processed/02/temp.pdb
---
warnings | Start residue of secondary structure not found: SHEET 1 1 1 ALA
A1123 THR A1127 0
Start residue of secondary structure not found: SHEET 2 2 1 HIS A1144 MET
A1149 0
Start residue of secondary structure not found: SHEET 3 3 1 LYS A1159 THR
A1161 0
Start residue of secondary structure not found: SHEET 4 4 1 GLY A1166 SER
A1176 0
Start residue of secondary structure not found: SHEET 5 5 1 LEU A1180 GLY
A1187 0
4 messages similar to the above omitted
Chain information for temp.pdb #4
---
Chain | Description
A | No description available
> select #4/A:33-58
163 atoms, 171 bonds, 26 residues, 1 model selected
> ui tool show "Show Sequence Viewer"
> sequence chain #4/A
Alignment identifier is 4/A
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_B_chainA_swissmodel.pdb
c1q_B_chainA_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_B_chainA_swissmodel.pdb #5
---
Chain | Description
A | No description available
> combine #4,5
Remapping chain ID 'A' in c1q_B_chainA_swissmodel.pdb #5 to 'B'
> select add #5
1611 atoms, 1654 bonds, 218 residues, 2 models selected
> select subtract #5
163 atoms, 171 bonds, 26 residues, 1 model selected
> select subtract #4
Nothing selected
> hide #3 models
> hide #4 models
> hide #5 models
> ui tool show "Show Sequence Viewer"
> sequence chain #6/A
Alignment identifier is 6/A
> select add #6
1611 atoms, 1654 bonds, 218 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel A
Proposed chainID change conflicts with existing residue combination #6/A GLY
33
> close #6
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/processed/02/temp.pdb
Summary of feedback from opening /Users/derekng/Dropbox/data-
shared/business/derekng/clients/invivo-redNucleus/2023/complement-
pathway/models/c1/processed/02/temp.pdb
---
warning | PDB SEQRES record for chain A is incomplete. Ignoring input sequence
records as basis for sequence.
Chain information for temp.pdb #6
---
Chain | Description
A | No description available
> ui tool show "Show Sequence Viewer"
> sequence chain #6/A
Alignment identifier is 6/A
> close #4
> close #5
> rename #6 id #4
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_B_chainA_swissmodel.pdb
c1q_B_chainA_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_B_chainA_swissmodel.pdb #5
---
Chain | Description
A | No description available
> ui tool show "Show Sequence Viewer"
> sequence chain #5/A
Alignment identifier is 5/A
> select #5/A:32
9 atoms, 8 bonds, 1 residue, 1 model selected
> select #5/A:32
9 atoms, 8 bonds, 1 residue, 1 model selected
> hide sel cartoons
> show sel atoms
> style sel ball
Changed 9 atom styles
> color sel byelement
> select #4/A:58
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #4/A:58
8 atoms, 7 bonds, 1 residue, 1 model selected
> style sel ball
Changed 8 atom styles
> hide sel cartoons
> show sel atoms
> color sel byelement
> select #4/A:58@C
1 atom, 1 residue, 1 model selected
> select #5/A:32@N
1 atom, 1 residue, 1 model selected
> select add #4/A:58@C
2 atoms, 2 residues, 2 models selected
> ui tool show "Build Structure"
> build join peptide sel length 1.33 omega 180 phi -120 move C
> ui tool show "Show Sequence Viewer"
> sequence chain #5/A
Alignment identifier is 5/A
> select add #5
1611 atoms, 1655 bonds, 218 residues, 1 model selected
> ui tool show "Build Structure"
> ui tool show "Show Sequence Viewer"
> sequence chain #5/A
Alignment identifier is 5/A
Drag select of 148 residues
> sequence associate #3/A
Associated c1q_B_chainA.pdb chain A to chain A with 0 mismatches
> sequence disassociate #5/A
Disassociated c1q_B_chainA_swissmodel.pdb chain A from chain A
> select clear
[Repeated 1 time(s)]
> select #3/A:41-42
11 atoms, 11 bonds, 2 residues, 1 model selected
> select #3/A:41-49
55 atoms, 58 bonds, 9 residues, 1 model selected
> select #3/A:35-36
12 atoms, 12 bonds, 2 residues, 1 model selected
> select #3/A:35-51
106 atoms, 111 bonds, 17 residues, 1 model selected
> select #3/A:57-58
12 atoms, 11 bonds, 2 residues, 1 model selected
> select #3/A:57-58
12 atoms, 11 bonds, 2 residues, 1 model selected
> show #3 models
> hide #3 models
> show #3 models
> show #2 models
> close #5
> close #3
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_B_chainA_swissmodel.pdb
c1q_B_chainA_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_B_chainA_swissmodel.pdb #3
---
Chain | Description
A | No description available
> select #2/A
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> select add #3
3096 atoms, 3173 bonds, 412 residues, 2 models selected
> select clear
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/modeling_0004.cxs
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainA/c1q_C_n_term.pdb
Chain information for c1q_C_n_term.pdb #4
---
Chain | Description
A | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainA/c1q_C_collagen_pre.pdb
Chain information for c1q_C_collagen_pre.pdb #5
---
Chain | Description
B | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainA/c1q_C_collagen_post.pdb
Chain information for c1q_C_collagen_post.pdb #6
---
Chain | Description
C | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainA/c1q_C_collagen_c_term.pdb
Chain information for c1q_C_collagen_c_term.pdb #7
---
Chain | Description
D | No description available
> hide #3 models
> hide #2 models
> combine #4,5,6,7
> hide #7 models
> hide #6 models
> hide #5 models
> hide #4 models
> select add #8
1526 atoms, 1560 bonds, 212 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel A
Chain IDs of 177 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/processed/02/c1q_C_chainA.pdb
> models #8 relModel #1
> select clear
> show #!1 models
> show #3 models
> hide #8 models
> hide #!1 models
> show #2 models
> select add #2
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> style sel sphere
Changed 1648 atom styles
> show sel atoms
> hide sel cartoons
> select add #3
3096 atoms, 3173 bonds, 412 residues, 2 models selected
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 3096 atom styles
> lighting soft
> lighting full
> select clear
> show #!1 models
> hide #!1 models
> show #8 models
> close #4-8
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_C_chainA_swissmodel.pdb
c1q_C_chainA_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_C_chainA_swissmodel.pdb #4
---
Chain | Description
A | No description available
> rename #3 c1q_B_chainA_swissmodel
> rename #4 c1q_C_chainA_swissmodel
> select clear
> select add #4
1593 atoms, 1645 bonds, 215 residues, 1 model selected
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1593 atom styles
> select clear
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/modeling_0005.cxs
> hide #2 models
> show #2 models
> show #!1 models
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/11.pdb
Chain information for 11.pdb #5
---
Chain | Description
E | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/12.pdb
Chain information for 12.pdb #6
---
Chain | Description
E | No description available
> color #6 #db613fff
> close #6
> sequence align P02745,#5/E
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain E with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain E with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain E with 0 mismatches
Associated c1q_A_chainA_swissmodel chain A to P02745 with 0 mismatches
Associated 11.pdb chain E to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 6NQIZ8JJ2C37D5JZ
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_A_n_term.pdb models #5
> relModel #1
> close #5
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/12.pdb
Chain information for 12.pdb #5
---
Chain | Description
E | No description available
> sequence align P02746,#5/E
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain E with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain E with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain E with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain E with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain E with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain E with 15 mismatches
Associated c1q_A_chainA_swissmodel chain A to chain E with 15 mismatches
Associated c1q_B_chainA_swissmodel chain A to P02746 with 0 mismatches
Associated c1q_C_chainA_swissmodel chain A to chain E with 15 mismatches
Associated 12.pdb chain E to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: U18IBA1EPOYS3HG0
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_B_n_term.pdb models #5
> relModel #1
> close #5
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/13.pdb
Chain information for 13.pdb #5
---
Chain | Description
E | No description available
F | No description available
> select #5/E:31-65
213 atoms, 216 bonds, 35 residues, 1 model selected
> select #5/F:62-87
164 atoms, 166 bonds, 26 residues, 1 model selected
> sequence align P02747,#5/E
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain E with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain E with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain E with 0 mismatches
Associated c1q_A_chainA_swissmodel chain A to chain E with 16 mismatches
Associated c1q_B_chainA_swissmodel chain A to chain E with 16 mismatches
Associated c1q_C_chainA_swissmodel chain A to P02747 with 0 mismatches
Associated 13.pdb chain E to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 9EBLRR20LTU8K8VK
> select #5/E:31-65
213 atoms, 216 bonds, 35 residues, 1 model selected
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_C_n_term.pdb models #5
> selectedOnly true relModel #1
> sequence align P02745,#5/F
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain F with 0 mismatches
Associated c1q_A_chainA_swissmodel chain A to P02745 with 0 mismatches
Associated c1q_B_chainA_swissmodel chain A to chain F with 11 mismatches
Associated c1q_C_chainA_swissmodel chain A to chain F with 10 mismatches
Associated 13.pdb chain F to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 730MQTOH0DCUCRBG
> select #5/F:62-87
164 atoms, 166 bonds, 26 residues, 1 model selected
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_A_collagen_pre.pdb
> models #5 selectedOnly true relModel #1
> close #5
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/14.pdb
Chain information for 14.pdb #5
---
Chain | Description
F | No description available
> sequence align P02746,#5/F
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain F with 11 mismatches
Associated c1q_A_chainA_swissmodel chain A to chain F with 11 mismatches
Associated c1q_B_chainA_swissmodel chain A to P02746 with 0 mismatches
Associated c1q_C_chainA_swissmodel chain A to chain F with 10 mismatches
Associated 14.pdb chain F to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: QNOIB961V9H27ICD
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_B_collagen_pre.pdb
> models #5 relModel #1
> close #5
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/15.pdb
Chain information for 15.pdb #5
---
Chain | Description
F | No description available
G | No description available
> sequence align P02747,#5/F
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain F with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain F with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain F with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain F with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain F with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain F with 10 mismatches
Associated c1q_A_chainA_swissmodel chain A to chain F with 10 mismatches
Associated c1q_B_chainA_swissmodel chain A to chain F with 10 mismatches
Associated c1q_C_chainA_swissmodel chain A to P02747 with 0 mismatches
Associated 15.pdb chain F to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 4STBLS1DF86D9HQ5
> ui tool show "Model Panel"
> select #5/F:67-91
160 atoms, 162 bonds, 25 residues, 1 model selected
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_C_collagen_pre.pdb
> models #5 selectedOnly true relModel #1
> sequence align P02745,#5/G
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain G with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain G with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain G with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain G with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain G with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain G with 0 mismatches
Associated c1q_A_chainA_swissmodel chain A to P02745 with 0 mismatches
Associated 15.pdb chain G to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 0F2CO1DO0FD0ARS9
> select #5/G:88-109
136 atoms, 136 bonds, 22 residues, 1 model selected
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_A_collagen_post.pdb
> models #5 selectedOnly true relModel #1
> close #5
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/16.pdb
Chain information for 16.pdb #5
---
Chain | Description
G | No description available
> sequence align P02746,#5/G
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain G with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain G with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain G with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain G with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain G with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain G with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain G with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain G with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain G with 0 mismatches
Associated c1q_B_chainA_swissmodel chain A to P02746 with 0 mismatches
Associated c1q_C_chainA_swissmodel chain A to chain G with 10 mismatches
Associated 16.pdb chain G to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: O7ULL0CINM7PB9ED
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_B_collagen_post.pdb
> models #5 relModel #1
> close #5
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/17.pdb
Chain information for 17.pdb #5
---
Chain | Description
G | No description available
> sequence align P02747,#5/G
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain G with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain G with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain G with 0 mismatches
Associated c1q_B_chainA_swissmodel chain A to chain G with 11 mismatches
Associated c1q_C_chainA_swissmodel chain A to P02747 with 0 mismatches
Associated 17.pdb chain G to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 78VLE6Z2MPXF4BWI
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_C_collagen_post.pdb
> models #5 relModel #1
> close #5
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/18.pdb
Chain information for 18.pdb #5
---
Chain | Description
H | No description available
> sequence align P02745,#5/H
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated c1q_A_chainA_swissmodel chain A to P02745 with 0 mismatches
Associated 18.pdb chain H to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: KL97A7SKIBR26KEU
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_A_collagen_c_term.pdb
> models #5 relModel #1
> close #5
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/19.pdb
Chain information for 19.pdb #5
---
Chain | Description
H | No description available
> sequence align P02746,#5/H
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain H with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain H with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain H with 0 mismatches
Associated c1q_B_chainA_swissmodel chain A to P02746 with 0 mismatches
Associated 19.pdb chain H to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: KI6AEM7KW79LILNB
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_B_collagen_c_term.pdb
> models #5 relModel #1
> close #5
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/20.pdb
Chain information for 20.pdb #5
---
Chain | Description
H | No description available
> sequence align P02747,#5/H
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain H with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain H with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain H with 0 mismatches
Associated c1q_C_chainA_swissmodel chain A to P02747 with 0 mismatches
Associated 20.pdb chain H to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 9FMXSWFU3JBNYQQ8
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_C_collagen_c_term.pdb
> models #5 relModel #1
> close #5
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_A_n_term.pdb
Chain information for c1q_A_n_term.pdb #5
---
Chain | Description
E | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_A_collagen_pre.pdb
Chain information for c1q_A_collagen_pre.pdb #6
---
Chain | Description
F | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_A_collagen_post.pdb
Chain information for c1q_A_collagen_post.pdb #7
---
Chain | Description
G | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_A_collagen_c_term.pdb
Chain information for c1q_A_collagen_c_term.pdb #8
---
Chain | Description
H | No description available
> hide #4 models
> hide #3 models
> hide #2 models
> show #3 models
> show #2 models
> show #4 models
> hide #!1 models
> combine #5,6,7,8
> hide #8 models
> hide #7 models
> hide #6 models
> hide #5 models
> select add #9
1570 atoms, 1596 bonds, 213 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel B
Chain IDs of 213 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainB/c1q_A_chainB.pdb models #9
> relModel #1
> close #5-9
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_B_n_term.pdb
Chain information for c1q_B_n_term.pdb #5
---
Chain | Description
E | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_B_collagen_pre.pdb
Chain information for c1q_B_collagen_pre.pdb #6
---
Chain | Description
F | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_B_collagen_post.pdb
Chain information for c1q_B_collagen_post.pdb #7
---
Chain | Description
G | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_B_collagen_c_term.pdb
Chain information for c1q_B_collagen_c_term.pdb #8
---
Chain | Description
H | No description available
> combine #5,6,7,8
> select add #9
1556 atoms, 1585 bonds, 215 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel B
Chain IDs of 215 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainB/c1q_B_chainB.pdb models #9
> relModel #1
> close #5-9
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_C_n_term.pdb
Chain information for c1q_C_n_term.pdb #5
---
Chain | Description
E | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_C_collagen_pre.pdb
Chain information for c1q_C_collagen_pre.pdb #6
---
Chain | Description
F | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_C_collagen_post.pdb
Chain information for c1q_C_collagen_post.pdb #7
---
Chain | Description
G | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainB/c1q_C_collagen_c_term.pdb
Chain information for c1q_C_collagen_c_term.pdb #8
---
Chain | Description
H | No description available
> combine #5,6,7,8
> select add #9
1526 atoms, 1560 bonds, 212 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel B
Chain IDs of 212 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainB/c1q_C_chainB.pdb models #9
> relModel #1
> close #5-9
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainB/c1q_A_chainB_swissmodel.pdb
c1q_A_chainB_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_A_chainB_swissmodel.pdb #5
---
Chain | Description
A | No description available
> rename #5 c1q_A_chainB_swissmodel
> select add #5
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel B
Chain IDs of 220 residues changed
> select subtract #5
Nothing selected
> select add #5
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1648 atom styles
> select clear
> show #!1 models
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainB/c1q_B_chainB_swissmodel.pdb
c1q_B_chainB_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_B_chainB_swissmodel.pdb #6
---
Chain | Description
A | No description available
> rename #6 c1q_B_chainB_swissmodel
> select add #6
1448 atoms, 1483 bonds, 192 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel B
Chain IDs of 192 residues changed
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1448 atom styles
> select clear
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainB/c1q_C_chainB_swissmodel.pdb
c1q_C_chainB_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_C_chainB_swissmodel.pdb #7
---
Chain | Description
A | No description available
> rename #7 c1q_C_chainB_swissmodel
> select add #7
1593 atoms, 1645 bonds, 215 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel B
Chain IDs of 215 residues changed
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1593 atom styles
> select clear
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/modeling_0006.cxs
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/21.pdb
Chain information for 21.pdb #8
---
Chain | Description
I | No description available
> sequence align P02745,#8/I
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain I with 0 mismatches
Associated c1q_A_chainA_swissmodel chain A to P02745 with 0 mismatches
Associated c1q_A_chainB_swissmodel chain B to P02745 with 0 mismatches
Associated 21.pdb chain I to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: F5PZHLX5RZ2UKWOQ
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_A_n_term.pdb models #8
> relModel #1
> close #8
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/22.pdb
Chain information for 22.pdb #8
---
Chain | Description
I | No description available
> sequence align P02746,#8/I
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain I with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain I with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain I with 15 mismatches
Associated c1q_A_chainA_swissmodel chain A to chain I with 15 mismatches
Associated c1q_B_chainA_swissmodel chain A to P02746 with 0 mismatches
Associated c1q_C_chainA_swissmodel chain A to chain I with 15 mismatches
Associated c1q_A_chainB_swissmodel chain B to chain I with 15 mismatches
Associated c1q_B_chainB_swissmodel chain B to P02746 with 0 mismatches
Associated c1q_C_chainB_swissmodel chain B to chain I with 15 mismatches
Associated 22.pdb chain I to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: IFCBECO5RJ75A8YZ
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_B_n_term.pdb models #8
> relModel #1
> close #8
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/23.pdb
Chain information for 23.pdb #8
---
Chain | Description
I | No description available
> sequence align P02747,#8/I
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain I with 0 mismatches
Associated c1q_A_chainA_swissmodel chain A to chain I with 16 mismatches
Associated c1q_B_chainA_swissmodel chain A to chain I with 16 mismatches
Associated c1q_C_chainA_swissmodel chain A to P02747 with 0 mismatches
Associated c1q_A_chainB_swissmodel chain B to chain I with 16 mismatches
Associated c1q_B_chainB_swissmodel chain B to chain I with 16 mismatches
Associated c1q_C_chainB_swissmodel chain B to P02747 with 0 mismatches
Associated 23.pdb chain I to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 9Y8NANDYY8AGPVTG
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_C_n_term.pdb models #8
> relModel #1
> close #8
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/24.pdb
Chain information for 24.pdb #8
---
Chain | Description
J | No description available
> sequence align P02745,#8/J
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain J with 0 mismatches
Associated c1q_A_chainA_swissmodel chain A to P02745 with 0 mismatches
Associated c1q_B_chainA_swissmodel chain A to chain J with 11 mismatches
Associated c1q_C_chainA_swissmodel chain A to chain J with 10 mismatches
Associated c1q_A_chainB_swissmodel chain B to P02745 with 0 mismatches
Associated c1q_B_chainB_swissmodel chain B to chain J with 11 mismatches
Associated c1q_C_chainB_swissmodel chain B to chain J with 10 mismatches
Associated 24.pdb chain J to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: V98JJ1WUIM39L6NB
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_A_collagen_pre.pdb
> models #8 relModel #1
> close #8
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/25.pdb
Chain information for 25.pdb #8
---
Chain | Description
J | No description available
> sequence align P02746,#8/J
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain J with 11 mismatches
Associated c1q_A_chainA_swissmodel chain A to chain J with 11 mismatches
Associated c1q_B_chainA_swissmodel chain A to P02746 with 0 mismatches
Associated c1q_C_chainA_swissmodel chain A to chain J with 10 mismatches
Associated c1q_A_chainB_swissmodel chain B to chain J with 11 mismatches
Associated c1q_B_chainB_swissmodel chain B to P02746 with 0 mismatches
Associated c1q_C_chainB_swissmodel chain B to chain J with 10 mismatches
Associated 25.pdb chain J to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: M9A9RZ4GC2S5XOFX
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_B_collagen_pre.pdb
> models #8 relModel #1
> close #8
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/26.pdb
Chain information for 26.pdb #8
---
Chain | Description
J | No description available
> sequence align P02747,#8/J
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain J with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain J with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain J with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain J with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain J with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain J with 10 mismatches
Associated c1q_A_chainA_swissmodel chain A to chain J with 10 mismatches
Associated c1q_B_chainA_swissmodel chain A to chain J with 10 mismatches
Associated c1q_C_chainA_swissmodel chain A to P02747 with 0 mismatches
Associated c1q_A_chainB_swissmodel chain B to chain J with 10 mismatches
Associated c1q_B_chainB_swissmodel chain B to chain J with 10 mismatches
Associated c1q_C_chainB_swissmodel chain B to P02747 with 0 mismatches
Associated 26.pdb chain J to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: SX95ZP07Z4WVHST4
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_C_collagen_pre.pdb
> models #8 relModel #1
> close #8
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/27.pdb
Chain information for 27.pdb #8
---
Chain | Description
K | No description available
> sequence align P02745,#8/K
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain K with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain K with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain K with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain K with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain K with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain K with 0 mismatches
Associated c1q_A_chainA_swissmodel chain A to P02745 with 0 mismatches
Associated c1q_A_chainB_swissmodel chain B to P02745 with 0 mismatches
Associated 27.pdb chain K to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: V44JTBXTOB30OMPA
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_A_collagen_post.pdb
> models #8 relModel #1
> close #8
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/28.pdb
Chain information for 28.pdb #8
---
Chain | Description
K | No description available
> sequence align P02746,#8/K
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain K with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain K with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain K with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain K with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain K with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain K with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain K with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain K with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain K with 0 mismatches
Associated c1q_B_chainA_swissmodel chain A to P02746 with 0 mismatches
Associated c1q_C_chainA_swissmodel chain A to chain K with 10 mismatches
Associated c1q_B_chainB_swissmodel chain B to P02746 with 0 mismatches
Associated c1q_C_chainB_swissmodel chain B to chain K with 10 mismatches
Associated 28.pdb chain K to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 5SNBBJJPQDWUL858
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_B_collagen_post.pdb
> models #8 relModel #1
> close #8
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/29.pdb
Chain information for 29.pdb #8
---
Chain | Description
K | No description available
> sequence align P02747,#8/K
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain K with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain K with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain K with 0 mismatches
Associated c1q_B_chainA_swissmodel chain A to chain K with 11 mismatches
Associated c1q_C_chainA_swissmodel chain A to P02747 with 0 mismatches
Associated c1q_B_chainB_swissmodel chain B to chain K with 11 mismatches
Associated c1q_C_chainB_swissmodel chain B to P02747 with 0 mismatches
Associated 29.pdb chain K to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: DOVJOBX428R6GPKJ
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_C_collagen_post.pdb
> models #8 relModel #1
> close #8
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/30.pdb
Chain information for 30.pdb #8
---
Chain | Description
L | No description available
> sequence align P02745,#8/L
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated c1q_A_chainA_swissmodel chain A to P02745 with 0 mismatches
Associated c1q_A_chainB_swissmodel chain B to P02745 with 0 mismatches
Associated 30.pdb chain L to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 018SL4XTUHUG5IR1
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_A_collagen_c_term.pdb
> models #8 relModel #1
> close #8
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/31.pdb
Chain information for 31.pdb #8
---
Chain | Description
L | No description available
> sequence align P02746,#8/L
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain L with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain L with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain L with 0 mismatches
Associated c1q_B_chainA_swissmodel chain A to P02746 with 0 mismatches
Associated c1q_B_chainB_swissmodel chain B to P02746 with 0 mismatches
Associated 31.pdb chain L to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 21S2HIHCUQE033PJ
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_B_collagen_c_term.pdb
> models #8 relModel #1
> close #8
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/32.pdb
Chain information for 32.pdb #8
---
Chain | Description
L | No description available
> sequence align P02747,#8/L
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain L with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain L with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain L with 0 mismatches
Associated c1q_C_chainA_swissmodel chain A to P02747 with 0 mismatches
Associated c1q_C_chainB_swissmodel chain B to P02747 with 0 mismatches
Associated 32.pdb chain L to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: WGYWB3CROO0SW0SA
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_C_collagen_c_term.pdb
> models #8 relModel #1
> close #8
> hide #!1 models
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_A_n_term.pdb
Chain information for c1q_A_n_term.pdb #8
---
Chain | Description
I | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_A_collagen_pre.pdb
Chain information for c1q_A_collagen_pre.pdb #9
---
Chain | Description
J | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_A_collagen_post.pdb
Chain information for c1q_A_collagen_post.pdb #10
---
Chain | Description
K | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_A_collagen_c_term.pdb
Chain information for c1q_A_collagen_c_term.pdb #11
---
Chain | Description
L | No description available
> combine #8,9,10,11
> select add #12
1570 atoms, 1596 bonds, 213 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel C
Chain IDs of 213 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainC/c1q_A_chainC.pdb models #12
> relModel #1
> close #8-12
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_B_n_term.pdb
Chain information for c1q_B_n_term.pdb #8
---
Chain | Description
I | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_B_collagen_pre.pdb
Chain information for c1q_B_collagen_pre.pdb #9
---
Chain | Description
J | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_B_collagen_post.pdb
Chain information for c1q_B_collagen_post.pdb #10
---
Chain | Description
K | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_B_collagen_c_term.pdb
Chain information for c1q_B_collagen_c_term.pdb #11
---
Chain | Description
L | No description available
> combine #8,9,10,11
> select add #12
1556 atoms, 1585 bonds, 215 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel C
Chain IDs of 215 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainC/c1q_B_chainC.pdb models #12
> relModel #1
> close #8-12
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_C_n_term.pdb
Chain information for c1q_C_n_term.pdb #8
---
Chain | Description
I | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_C_collagen_pre.pdb
Chain information for c1q_C_collagen_pre.pdb #9
---
Chain | Description
J | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_C_collagen_post.pdb
Chain information for c1q_C_collagen_post.pdb #10
---
Chain | Description
K | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainC/c1q_C_collagen_c_term.pdb
Chain information for c1q_C_collagen_c_term.pdb #11
---
Chain | Description
L | No description available
> combine #8,9,10,11
> select add #12
1526 atoms, 1560 bonds, 212 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel C
Chain IDs of 212 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainC/c1q_C_chainC.pdb models #12
> relModel #1
> close #8-12
> show #!1 models
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/33.pdb
Chain information for 33.pdb #8
---
Chain | Description
M | No description available
> close #8
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainC/c1q_A_chainC_swissmodel.pdb
c1q_A_chainC_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_A_chainC_swissmodel.pdb #8
---
Chain | Description
A | No description available
> hide #!1 models
> rename #8 c1q_A_chainC_swissmodel
> select add #8
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel C
Chain IDs of 220 residues changed
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1648 atom styles
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainC/c1q_B_chainC_swissmodel.pdb
c1q_B_chainC_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_B_chainC_swissmodel.pdb #9
---
Chain | Description
A | No description available
> select subtract #8
Nothing selected
> select add #9
1448 atoms, 1483 bonds, 192 residues, 1 model selected
> hide #8 models
> show #8 models
> ui tool show "Change Chain IDs"
> changechains sel C
Chain IDs of 192 residues changed
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1448 atom styles
> select clear
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainC/c1q_C_chainC_swissmodel.pdb
c1q_C_chainC_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_C_chainC_swissmodel.pdb #10
---
Chain | Description
A | No description available
> rename #9 c1q_B_chainC_swissmodel
> rename #10 c1q_C_chainC_swissmodel
> select add #10
1593 atoms, 1645 bonds, 215 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel C
Chain IDs of 215 residues changed
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1593 atom styles
> select clear
> rename #10 c1q_C_chainC
> rename #9 c1q_B_chainC
> rename #8 c1q_A_chainC
> rename #7 c1q_C_chainB
> rename #6 c1q_B_chainB
> rename #5 c1q_A_chainB
> rename #4 c1q_C_chainA
> rename #3 c1q_B_chainA
> rename #2 c1q_A_chainA
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/modeling_0007.cxs
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/34.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/35.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/36.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/37.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/38.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/39.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/40.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/41.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/42.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/43.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/44.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/45.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/46.pdb
Chain information for 34.pdb #11
---
Chain | Description
O | No description available
Chain information for 35.pdb #12
---
Chain | Description
P | No description available
Chain information for 36.pdb #13
---
Chain | Description
Q | No description available
Chain information for 37.pdb #14
---
Chain | Description
R | No description available
Chain information for 38.pdb #15
---
Chain | Description
A | No description available
Chain information for 39.pdb #16
---
Chain | Description
A | No description available
Chain information for 40.pdb #17
---
Chain | Description
A | No description available
Chain information for 41.pdb #18
---
Chain | Description
B | No description available
Chain information for 42.pdb #19
---
Chain | Description
B | No description available
Chain information for 43.pdb #20
---
Chain | Description
B | No description available
Chain information for 44.pdb #21
---
Chain | Description
C | No description available
Chain information for 45.pdb #22
---
Chain | Description
C | No description available
Chain information for 46.pdb #23
---
Chain | Description
C | No description available
> hide #11 models
> hide #12 models
> hide #13 models
> hide #14 models
> hide #15 models
> show #15 models
> close #11-23
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/38.pdb
Chain information for 38.pdb #11
---
Chain | Description
A | No description available
> sequence align P02745,#11/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain A with 0 mismatches
Associated c1q_A_chainA chain A to P02745 with 0 mismatches
Associated c1q_A_chainB chain B to P02745 with 0 mismatches
Associated c1q_A_chainC chain C to P02745 with 0 mismatches
Associated 38.pdb chain A to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: EUGTFO56KJ43DBDU
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_A_n_term.pdb models
> #11 relModel #1
> close #11
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/39.pdb
Chain information for 39.pdb #11
---
Chain | Description
A | No description available
> sequence align P02746,#11/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain A with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain A with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain A with 15 mismatches
Associated c1q_A_chainA chain A to chain A with 15 mismatches
Associated c1q_B_chainA chain A to P02746 with 0 mismatches
Associated c1q_C_chainA chain A to chain A with 15 mismatches
Associated c1q_A_chainB chain B to chain A with 15 mismatches
Associated c1q_B_chainB chain B to P02746 with 0 mismatches
Associated c1q_C_chainB chain B to chain A with 15 mismatches
Associated c1q_A_chainC chain C to chain A with 15 mismatches
Associated c1q_B_chainC chain C to P02746 with 0 mismatches
Associated c1q_C_chainC chain C to chain A with 15 mismatches
Associated 39.pdb chain A to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: DE7F0M6BRA5Z4ZLD
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_B_n_term.pdb models
> #11 relModel #1
> close #11
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/40.pdb
Chain information for 40.pdb #11
---
Chain | Description
A | No description available
> sequence align P02747,#11/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain A with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain A with 0 mismatches
Associated c1q_A_chainA chain A to chain A with 16 mismatches
Associated c1q_B_chainA chain A to chain A with 16 mismatches
Associated c1q_C_chainA chain A to P02747 with 0 mismatches
Associated c1q_A_chainB chain B to chain A with 16 mismatches
Associated c1q_B_chainB chain B to chain A with 16 mismatches
Associated c1q_C_chainB chain B to P02747 with 0 mismatches
Associated c1q_A_chainC chain C to chain A with 16 mismatches
Associated c1q_B_chainC chain C to chain A with 16 mismatches
Associated c1q_C_chainC chain C to P02747 with 0 mismatches
Associated 40.pdb chain A to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 334HZCQTLK1824O8
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_C_n_term.pdb models
> #11 relModel #1
> close #11
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/41.pdb
Chain information for 41.pdb #11
---
Chain | Description
B | No description available
> sequence align P02745,#11/B
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain B with 0 mismatches
Associated c1q_A_chainA chain A to P02745 with 0 mismatches
Associated c1q_B_chainA chain A to chain B with 11 mismatches
Associated c1q_C_chainA chain A to chain B with 10 mismatches
Associated c1q_A_chainB chain B to P02745 with 0 mismatches
Associated c1q_B_chainB chain B to chain B with 11 mismatches
Associated c1q_C_chainB chain B to chain B with 10 mismatches
Associated c1q_A_chainC chain C to P02745 with 0 mismatches
Associated c1q_B_chainC chain C to chain B with 11 mismatches
Associated c1q_C_chainC chain C to chain B with 10 mismatches
Associated 41.pdb chain B to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: WKQTOREZFARHH080
> ui tool show "Model Panel"
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_A_collagen_pre.pdb
> models #11 relModel #1
> close #11
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/42.pdb
Chain information for 42.pdb #11
---
Chain | Description
B | No description available
> sequence align P02746,#11/B
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain B with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain B with 11 mismatches
Associated c1q_A_chainA chain A to chain B with 11 mismatches
Associated c1q_B_chainA chain A to P02746 with 0 mismatches
Associated c1q_C_chainA chain A to chain B with 10 mismatches
Associated c1q_A_chainB chain B to chain B with 11 mismatches
Associated c1q_B_chainB chain B to P02746 with 0 mismatches
Associated c1q_C_chainB chain B to chain B with 10 mismatches
Associated c1q_A_chainC chain C to chain B with 11 mismatches
Associated c1q_B_chainC chain C to P02746 with 0 mismatches
Associated c1q_C_chainC chain C to chain B with 10 mismatches
Associated 42.pdb chain B to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: XCNWPXJSXSO655J3
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_B_collagen_pre.pdb
> models #11 relModel #1
> close #11
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/43.pdb
Chain information for 43.pdb #11
---
Chain | Description
B | No description available
> sequence align P02747,#11/B
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain B with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain B with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain B with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain B with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain B with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain B with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain B with 10 mismatches
Associated c1q_A_chainA chain A to chain B with 10 mismatches
Associated c1q_B_chainA chain A to chain B with 10 mismatches
Associated c1q_C_chainA chain A to P02747 with 0 mismatches
Associated c1q_A_chainB chain B to chain B with 10 mismatches
Associated c1q_B_chainB chain B to chain B with 10 mismatches
Associated c1q_C_chainB chain B to P02747 with 0 mismatches
Associated c1q_A_chainC chain C to chain B with 10 mismatches
Associated c1q_B_chainC chain C to chain B with 10 mismatches
Associated c1q_C_chainC chain C to P02747 with 0 mismatches
Associated 43.pdb chain B to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: BDQYFGAN3SYZYBTE
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_C_collagen_pre.pdb
> models #11 relModel #1
> close #11
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/44.pdb
Chain information for 44.pdb #11
---
Chain | Description
C | No description available
> sequence align P02745,#11/C
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain C with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain C with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain C with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain C with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain C with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain C with 0 mismatches
Associated c1q_A_chainA chain A to P02745 with 0 mismatches
Associated c1q_A_chainB chain B to P02745 with 0 mismatches
Associated c1q_A_chainC chain C to P02745 with 0 mismatches
Associated 44.pdb chain C to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: F3VPUBVFQQM0J6AG
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_A_collagen_post.pdb
> models #11 relModel #1
> close #11
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/45.pdb
Chain information for 45.pdb #11
---
Chain | Description
C | No description available
> sequence align P02746,#11/C
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain C with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain C with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain C with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain C with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain C with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain C with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain C with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain C with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain C with 0 mismatches
Associated c1q_B_chainA chain A to P02746 with 0 mismatches
Associated c1q_C_chainA chain A to chain C with 10 mismatches
Associated c1q_B_chainB chain B to P02746 with 0 mismatches
Associated c1q_C_chainB chain B to chain C with 10 mismatches
Associated c1q_B_chainC chain C to P02746 with 0 mismatches
Associated c1q_C_chainC chain C to chain C with 10 mismatches
Associated 45.pdb chain C to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: SF2MQIR24WWK722C
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_B_collagen_post.pdb
> models #11 relModel #1
> close #11
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/46.pdb
Chain information for 46.pdb #11
---
Chain | Description
C | No description available
> sequence align P02747,#11/C
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain C with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain C with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain C with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain C with 0 mismatches
Associated c1q_B_chainA chain A to chain C with 11 mismatches
Associated c1q_C_chainA chain A to P02747 with 0 mismatches
Associated c1q_B_chainB chain B to chain C with 11 mismatches
Associated c1q_C_chainB chain B to P02747 with 0 mismatches
Associated c1q_B_chainC chain C to chain C with 11 mismatches
Associated c1q_C_chainC chain C to P02747 with 0 mismatches
Associated 46.pdb chain C to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: OEA889U5XHNR0PKO
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_C_collagen_post.pdb
> models #11 relModel #1
> close #11
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/47.pdb
Chain information for 47.pdb #11
---
Chain | Description
D | No description available
> sequence align P02745,#11/D
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated c1q_A_chainA chain A to P02745 with 0 mismatches
Associated c1q_A_chainB chain B to P02745 with 0 mismatches
Associated c1q_A_chainC chain C to P02745 with 0 mismatches
Associated 47.pdb chain D to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: AMGBZUS0X7ESJL35
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_A_collagen_c_term.pdb
> models #11 relModel #1
> close #11
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/48.pdb
Chain information for 48.pdb #11
---
Chain | Description
D | No description available
> sequence align P02746,#11/D
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain D with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain D with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain D with 0 mismatches
Associated c1q_B_chainA chain A to P02746 with 0 mismatches
Associated c1q_B_chainB chain B to P02746 with 0 mismatches
Associated c1q_B_chainC chain C to P02746 with 0 mismatches
Associated 48.pdb chain D to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 3DPTKSXXK4N6WHZ9
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_B_collagen_c_term.pdb
> models #11 relModel #1
> close #11
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/49.pdb
Chain information for 49.pdb #11
---
Chain | Description
D | No description available
> sequence align P02747,#11/D
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain D with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain D with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain D with 0 mismatches
Associated c1q_C_chainA chain A to P02747 with 0 mismatches
Associated c1q_C_chainB chain B to P02747 with 0 mismatches
Associated c1q_C_chainC chain C to P02747 with 0 mismatches
Associated 49.pdb chain D to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: ABC46Y936KL426S3
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_C_collagen_c_term.pdb
> models #11 relModel #1
> close #11
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_A_n_term.pdb
Chain information for c1q_A_n_term.pdb #11
---
Chain | Description
A | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_A_collagen_pre.pdb
Chain information for c1q_A_collagen_pre.pdb #12
---
Chain | Description
B | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_A_collagen_post.pdb
Chain information for c1q_A_collagen_post.pdb #13
---
Chain | Description
C | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_A_collagen_c_term.pdb
Chain information for c1q_A_collagen_c_term.pdb #14
---
Chain | Description
D | No description available
> combine #11,12,13,14
> select add #15
1570 atoms, 1596 bonds, 213 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel D
Chain IDs of 83 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainD/c1q_A_chainD.pdb models #15
> relModel #1
> close #11-15
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_B_n_term.pdb
Chain information for c1q_B_n_term.pdb #11
---
Chain | Description
A | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_B_collagen_pre.pdb
Chain information for c1q_B_collagen_pre.pdb #12
---
Chain | Description
B | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_B_collagen_post.pdb
Chain information for c1q_B_collagen_post.pdb #13
---
Chain | Description
C | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_B_collagen_c_term.pdb
Chain information for c1q_B_collagen_c_term.pdb #14
---
Chain | Description
D | No description available
> combine #11,12,13,14
> select add #15
1556 atoms, 1585 bonds, 215 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel D
Chain IDs of 83 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainD/c1q_B_chainD.pdb models #15
> relModel #1
> close #11-15
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_C_n_term.pdb
Chain information for c1q_C_n_term.pdb #11
---
Chain | Description
A | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_C_collagen_pre.pdb
Chain information for c1q_C_collagen_pre.pdb #12
---
Chain | Description
B | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_C_collagen_post.pdb
Chain information for c1q_C_collagen_post.pdb #13
---
Chain | Description
C | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainD/c1q_C_collagen_c_term.pdb
Chain information for c1q_C_collagen_c_term.pdb #14
---
Chain | Description
D | No description available
> combine #11,12,13,14
> select add #15
1526 atoms, 1560 bonds, 212 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel D
Chain IDs of 83 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainD/c1q_C_chainD.pdb models #15
> relModel #1
> close #11-15
> select add #1
49238 atoms, 50348 bonds, 6538 residues, 1 model selected
> select subtract #1
Nothing selected
> show #!1 models
> view
> select H
Nothing selected
> select clear
> select add #2
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> select add #10
3241 atoms, 3335 bonds, 435 residues, 2 models selected
> select add #9
4689 atoms, 4818 bonds, 627 residues, 3 models selected
> select add #8
6337 atoms, 6508 bonds, 847 residues, 4 models selected
> select add #7
7930 atoms, 8153 bonds, 1062 residues, 5 models selected
> select add #6
9378 atoms, 9636 bonds, 1254 residues, 6 models selected
> select add #5
11026 atoms, 11326 bonds, 1474 residues, 7 models selected
> select add #4
12619 atoms, 12971 bonds, 1689 residues, 8 models selected
> select add #3
14067 atoms, 14454 bonds, 1881 residues, 9 models selected
> color sel white
> select clear
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainD/c1q_A_chainD_swissmodel.pdb
c1q_A_chainD_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_A_chainD_swissmodel.pdb #11
---
Chain | Description
A | No description available
> rename #11 c1q_A_chainD
> select add #11
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel D
Chain IDs of 220 residues changed
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1648 atom styles
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainD/c1q_B_chainD_swissmodel.pdb
c1q_B_chainD_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_B_chainD_swissmodel.pdb #12
---
Chain | Description
A | No description available
> rename #12 c1q_B_chainD
> select subtract #11
Nothing selected
> select add #12
1448 atoms, 1483 bonds, 192 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel D
Chain IDs of 192 residues changed
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1448 atom styles
> select clear
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainD/c1q_C_chainD_swissmodel.pdb
c1q_C_chainD_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_C_chainD_swissmodel.pdb #13
---
Chain | Description
A | No description available
> rename #13 c1q_C_chainD
> select add #13
1593 atoms, 1645 bonds, 215 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel D
Chain IDs of 215 residues changed
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1593 atom styles
> select clear
> select add #11
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> select add #12
3096 atoms, 3173 bonds, 412 residues, 2 models selected
> select add #13
4689 atoms, 4818 bonds, 627 residues, 3 models selected
> color sel white
> select clear
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/modeling_0008.cxs
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/50.pdb
Chain information for 50.pdb #14
---
Chain | Description
E | No description available
> hide #!1 models
> sequence align P02745,#14/E
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain E with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain E with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain E with 0 mismatches
Associated c1q_A_chainA chain A to P02745 with 0 mismatches
Associated c1q_A_chainB chain B to P02745 with 0 mismatches
Associated c1q_A_chainC chain C to P02745 with 0 mismatches
Associated c1q_A_chainD chain D to P02745 with 0 mismatches
Associated 50.pdb chain E to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: OBGE5H1ZP7ODHI9D
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_A_n_term.pdb models
> #14 relModel #1
> close #14
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/51.pdb
Chain information for 51.pdb #14
---
Chain | Description
E | No description available
> sequence align P02746,#14/E
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain E with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain E with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain E with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain E with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain E with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain E with 15 mismatches
Associated c1q_A_chainA chain A to chain E with 15 mismatches
Associated c1q_B_chainA chain A to P02746 with 0 mismatches
Associated c1q_C_chainA chain A to chain E with 15 mismatches
Associated c1q_A_chainB chain B to chain E with 15 mismatches
Associated c1q_B_chainB chain B to P02746 with 0 mismatches
Associated c1q_C_chainB chain B to chain E with 15 mismatches
Associated c1q_A_chainC chain C to chain E with 15 mismatches
Associated c1q_B_chainC chain C to P02746 with 0 mismatches
Associated c1q_C_chainC chain C to chain E with 15 mismatches
Associated c1q_A_chainD chain D to chain E with 15 mismatches
Associated c1q_B_chainD chain D to P02746 with 0 mismatches
Associated c1q_C_chainD chain D to chain E with 15 mismatches
Associated 51.pdb chain E to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: RN5F4HLJ37LHN5RL
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_B_n_term.pdb models
> #14 relModel #1
> close #14
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/52.pdb
Chain information for 52.pdb #14
---
Chain | Description
E | No description available
> sequence align P02747,#14/E
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain E with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain E with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain E with 0 mismatches
Associated c1q_A_chainA chain A to chain E with 16 mismatches
Associated c1q_B_chainA chain A to chain E with 16 mismatches
Associated c1q_C_chainA chain A to P02747 with 0 mismatches
Associated c1q_A_chainB chain B to chain E with 16 mismatches
Associated c1q_B_chainB chain B to chain E with 16 mismatches
Associated c1q_C_chainB chain B to P02747 with 0 mismatches
Associated c1q_A_chainC chain C to chain E with 16 mismatches
Associated c1q_B_chainC chain C to chain E with 16 mismatches
Associated c1q_C_chainC chain C to P02747 with 0 mismatches
Associated c1q_A_chainD chain D to chain E with 16 mismatches
Associated c1q_B_chainD chain D to chain E with 16 mismatches
Associated c1q_C_chainD chain D to P02747 with 0 mismatches
Associated 52.pdb chain E to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: TGYLSBAYN2M42LUS
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_C_n_term.pdb models
> #14 relModel #1
> close #14
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/53.pdb
Chain information for 53.pdb #14
---
Chain | Description
F | No description available
> sequence align P02745,#14/F
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain F with 0 mismatches
Associated c1q_A_chainA chain A to P02745 with 0 mismatches
Associated c1q_B_chainA chain A to chain F with 11 mismatches
Associated c1q_C_chainA chain A to chain F with 10 mismatches
Associated c1q_A_chainB chain B to P02745 with 0 mismatches
Associated c1q_B_chainB chain B to chain F with 11 mismatches
Associated c1q_C_chainB chain B to chain F with 10 mismatches
Associated c1q_A_chainC chain C to P02745 with 0 mismatches
Associated c1q_B_chainC chain C to chain F with 11 mismatches
Associated c1q_C_chainC chain C to chain F with 10 mismatches
Associated c1q_A_chainD chain D to P02745 with 0 mismatches
Associated c1q_B_chainD chain D to chain F with 11 mismatches
Associated c1q_C_chainD chain D to chain F with 10 mismatches
Associated 53.pdb chain F to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: QAA9R63RC63AE5VZ
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_A_collagen_pre.pdb
> models #14 relModel #1
> close #14
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/54.pdb
Chain information for 54.pdb #14
---
Chain | Description
F | No description available
> sequence align P02746,#14/F
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain F with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain F with 11 mismatches
Associated c1q_A_chainA chain A to chain F with 11 mismatches
Associated c1q_B_chainA chain A to P02746 with 0 mismatches
Associated c1q_C_chainA chain A to chain F with 10 mismatches
Associated c1q_A_chainB chain B to chain F with 11 mismatches
Associated c1q_B_chainB chain B to P02746 with 0 mismatches
Associated c1q_C_chainB chain B to chain F with 10 mismatches
Associated c1q_A_chainC chain C to chain F with 11 mismatches
Associated c1q_B_chainC chain C to P02746 with 0 mismatches
Associated c1q_C_chainC chain C to chain F with 10 mismatches
Associated c1q_A_chainD chain D to chain F with 11 mismatches
Associated c1q_B_chainD chain D to P02746 with 0 mismatches
Associated c1q_C_chainD chain D to chain F with 10 mismatches
Associated 54.pdb chain F to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: NJON53RPPNHMMQUC
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_B_collagen_pre.pdb
> models #14 relModel #1
> close #14
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/55.pdb
Chain information for 55.pdb #14
---
Chain | Description
F | No description available
> sequence align P02747,#14/F
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain F with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain F with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain F with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain F with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain F with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain F with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain F with 10 mismatches
Associated c1q_A_chainA chain A to chain F with 10 mismatches
Associated c1q_B_chainA chain A to chain F with 10 mismatches
Associated c1q_C_chainA chain A to P02747 with 0 mismatches
Associated c1q_A_chainB chain B to chain F with 10 mismatches
Associated c1q_B_chainB chain B to chain F with 10 mismatches
Associated c1q_C_chainB chain B to P02747 with 0 mismatches
Associated c1q_A_chainC chain C to chain F with 10 mismatches
Associated c1q_B_chainC chain C to chain F with 10 mismatches
Associated c1q_C_chainC chain C to P02747 with 0 mismatches
Associated c1q_A_chainD chain D to chain F with 10 mismatches
Associated c1q_B_chainD chain D to chain F with 10 mismatches
Associated c1q_C_chainD chain D to P02747 with 0 mismatches
Associated 55.pdb chain F to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 7U624CQ3V6L2TUD7
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_C_collagen_pre.pdb
> models #14 relModel #1
> close #14
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/56.pdb
Chain information for 56.pdb #14
---
Chain | Description
G | No description available
> sequence align P02745,#14/G
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain G with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain G with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain G with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain G with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain G with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain G with 0 mismatches
Associated c1q_A_chainA chain A to P02745 with 0 mismatches
Associated c1q_A_chainB chain B to P02745 with 0 mismatches
Associated c1q_A_chainC chain C to P02745 with 0 mismatches
Associated c1q_A_chainD chain D to P02745 with 0 mismatches
Associated 56.pdb chain G to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 6K3EDP8G6WKBNQ0K
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_A_collagen_post.pdb
> models #14 relModel #1
> close #14
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/57.pdb
Chain information for 57.pdb #14
---
Chain | Description
G | No description available
> sequence align P02746,#14/G
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain G with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain G with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain G with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain G with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain G with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain G with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain G with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain G with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain G with 0 mismatches
Associated c1q_B_chainA chain A to P02746 with 0 mismatches
Associated c1q_C_chainA chain A to chain G with 10 mismatches
Associated c1q_B_chainB chain B to P02746 with 0 mismatches
Associated c1q_C_chainB chain B to chain G with 10 mismatches
Associated c1q_B_chainC chain C to P02746 with 0 mismatches
Associated c1q_C_chainC chain C to chain G with 10 mismatches
Associated c1q_B_chainD chain D to P02746 with 0 mismatches
Associated c1q_C_chainD chain D to chain G with 10 mismatches
Associated 57.pdb chain G to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 27L4SHQZGDLLN495
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_B_collagen_post.pdb
> models #14 relModel #1
> close #14
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/58.pdb
Chain information for 58.pdb #14
---
Chain | Description
G | No description available
> sequence align P02747,#14/G
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain G with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain G with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain G with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain G with 0 mismatches
Associated c1q_B_chainA chain A to chain G with 11 mismatches
Associated c1q_C_chainA chain A to P02747 with 0 mismatches
Associated c1q_B_chainB chain B to chain G with 11 mismatches
Associated c1q_C_chainB chain B to P02747 with 0 mismatches
Associated c1q_B_chainC chain C to chain G with 11 mismatches
Associated c1q_C_chainC chain C to P02747 with 0 mismatches
Associated c1q_B_chainD chain D to chain G with 11 mismatches
Associated c1q_C_chainD chain D to P02747 with 0 mismatches
Associated 58.pdb chain G to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: VJFFDC673IZB2CC8
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_C_collagen_post.pdb
> models #14 relModel #1
> close #14
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/59.pdb
Chain information for 59.pdb #14
---
Chain | Description
H | No description available
> lighting full
> lighting soft
> lighting simple
> lighting soft
> lighting full
> show #!1 models
> hide #!1 models
> sequence align P02745,#14/H
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated c1q_A_chainA chain A to P02745 with 0 mismatches
Associated c1q_A_chainB chain B to P02745 with 0 mismatches
Associated c1q_A_chainC chain C to P02745 with 0 mismatches
Associated c1q_A_chainD chain D to P02745 with 0 mismatches
Associated 59.pdb chain H to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: LERIWYFFLUGQ2CX5
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_A_collagen_c_term.pdb
> models #14 relModel #1
> close #14
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/60.pdb
Chain information for 60.pdb #14
---
Chain | Description
H | No description available
> sequence align P02746,#14/H
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain H with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain H with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain H with 0 mismatches
Associated c1q_B_chainA chain A to P02746 with 0 mismatches
Associated c1q_B_chainB chain B to P02746 with 0 mismatches
Associated c1q_B_chainC chain C to P02746 with 0 mismatches
Associated c1q_B_chainD chain D to P02746 with 0 mismatches
Associated 60.pdb chain H to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: JJZ5RX0COHQ3J5V2
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_B_collagen_c_term.pdb
> models #14 relModel #1
> close #14
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/61.pdb
Chain information for 61.pdb #14
---
Chain | Description
H | No description available
> sequence align P02747,#14/H
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain H with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain H with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain H with 0 mismatches
Associated c1q_C_chainA chain A to P02747 with 0 mismatches
Associated c1q_C_chainB chain B to P02747 with 0 mismatches
Associated c1q_C_chainC chain C to P02747 with 0 mismatches
Associated c1q_C_chainD chain D to P02747 with 0 mismatches
Associated 61.pdb chain H to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: J3EQ2IL8U6QYBKKJ
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_C_collagen_c_term.pdb
> models #14 relModel #1
> close #14
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_A_n_term.pdb
Chain information for c1q_A_n_term.pdb #14
---
Chain | Description
E | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_A_collagen_pre.pdb
Chain information for c1q_A_collagen_pre.pdb #15
---
Chain | Description
F | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_A_collagen_post.pdb
Chain information for c1q_A_collagen_post.pdb #16
---
Chain | Description
G | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_A_collagen_c_term.pdb
Chain information for c1q_A_collagen_c_term.pdb #17
---
Chain | Description
H | No description available
> combine #14,15,16,17
> select add #18
1570 atoms, 1596 bonds, 213 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel E
Chain IDs of 178 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainE/c1q_A_chainE.pdb models #18
> relModel #1
> close #14-18
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_B_n_term.pdb
Chain information for c1q_B_n_term.pdb #14
---
Chain | Description
E | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_B_collagen_pre.pdb
Chain information for c1q_B_collagen_pre.pdb #15
---
Chain | Description
F | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_B_collagen_post.pdb
Chain information for c1q_B_collagen_post.pdb #16
---
Chain | Description
G | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_B_collagen_c_term.pdb
Chain information for c1q_B_collagen_c_term.pdb #17
---
Chain | Description
H | No description available
> combine #14,15,16,17
> select add #18
1556 atoms, 1585 bonds, 215 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel E
Chain IDs of 180 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainE/c1q_B_chainE.pdb models #18
> relModel #1
> close #14-18
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_C_n_term.pdb
Chain information for c1q_C_n_term.pdb #14
---
Chain | Description
E | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_C_collagen_pre.pdb
Chain information for c1q_C_collagen_pre.pdb #15
---
Chain | Description
F | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_C_collagen_post.pdb
Chain information for c1q_C_collagen_post.pdb #16
---
Chain | Description
G | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainE/c1q_C_collagen_c_term.pdb
Chain information for c1q_C_collagen_c_term.pdb #17
---
Chain | Description
H | No description available
> combine #14,15,16,17
> select add #18
1526 atoms, 1560 bonds, 212 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel E
Chain IDs of 177 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainE/c1q_C_chainE.pdb models #18
> relModel #1
> close #14-18
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainE/c1q_A_chainE_swissmodel.pdb
c1q_A_chainE_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_A_chainE_swissmodel.pdb #14
---
Chain | Description
A | No description available
> rename #14 c1q_A_chainE
> select add #14
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel E
Chain IDs of 220 residues changed
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1648 atom styles
> color sel white
> select subtract #14
Nothing selected
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainE/c1q_B_chainE_swissmodel.pdb
c1q_B_chainE_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_B_chainE_swissmodel.pdb #15
---
Chain | Description
A | No description available
> select add #15
1448 atoms, 1483 bonds, 192 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel E
Chain IDs of 192 residues changed
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1448 atom styles
> color sel white
> select clear
> rename #15 c1q_B_chainE
> ui tool show "Show Sequence Viewer"
> sequence chain #15/E
Alignment identifier is 15/E
> select #15/E:32
9 atoms, 8 bonds, 1 residue, 1 model selected
> select #15/E
1448 atoms, 1483 bonds, 192 residues, 1 model selected
> ui tool show "Show Sequence Viewer"
> sequence chain #14/E
Alignment identifier is 14/E
> select #14/E:3-4
14 atoms, 13 bonds, 2 residues, 1 model selected
> select #14/E
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> select subtract #14
Nothing selected
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainE/c1q_C_chainE_swissmodel.pdb
c1q_C_chainE_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_C_chainE_swissmodel.pdb #16
---
Chain | Description
A | No description available
> rename #16 c1q_C_chainE
> select add #16
1593 atoms, 1645 bonds, 215 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel E
Chain IDs of 215 residues changed
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1593 atom styles
> color sel white
> select clear
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/modeling_0009.cxs
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/62.pdb
Chain information for 62.pdb #17
---
Chain | Description
I | No description available
> sequence align P02745,#17/I
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain I with 0 mismatches
Associated c1q_A_chainA chain A to P02745 with 0 mismatches
Associated c1q_A_chainB chain B to P02745 with 0 mismatches
Associated c1q_A_chainC chain C to P02745 with 0 mismatches
Associated c1q_A_chainD chain D to P02745 with 0 mismatches
Associated c1q_A_chainE chain E to P02745 with 0 mismatches
Associated 62.pdb chain I to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: RGPWGYU4DJURNARI
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_A_n_term.pdb models
> #17 relModel #1
> close #17
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/63.pdb
Chain information for 63.pdb #17
---
Chain | Description
I | No description available
> sequence align P02746,#17/I
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain I with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain I with 15 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain I with 15 mismatches
Associated c1q_A_chainA chain A to chain I with 15 mismatches
Associated c1q_B_chainA chain A to P02746 with 0 mismatches
Associated c1q_C_chainA chain A to chain I with 15 mismatches
Associated c1q_A_chainB chain B to chain I with 15 mismatches
Associated c1q_B_chainB chain B to P02746 with 0 mismatches
Associated c1q_C_chainB chain B to chain I with 15 mismatches
Associated c1q_A_chainC chain C to chain I with 15 mismatches
Associated c1q_B_chainC chain C to P02746 with 0 mismatches
Associated c1q_C_chainC chain C to chain I with 15 mismatches
Associated c1q_A_chainD chain D to chain I with 15 mismatches
Associated c1q_B_chainD chain D to P02746 with 0 mismatches
Associated c1q_C_chainD chain D to chain I with 15 mismatches
Associated c1q_A_chainE chain E to chain I with 15 mismatches
Associated c1q_B_chainE chain E to P02746 with 0 mismatches
Associated c1q_C_chainE chain E to chain I with 15 mismatches
Associated 63.pdb chain I to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: EDQLS9VW8HI8OT1L
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_B_n_term.pdb models
> #17 relModel #1
> close #17
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/64.pdb
Chain information for 64.pdb #17
---
Chain | Description
I | No description available
> sequence align P02747,#17/I
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain I with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain I with 0 mismatches
Associated c1q_A_chainA chain A to chain I with 16 mismatches
Associated c1q_B_chainA chain A to chain I with 16 mismatches
Associated c1q_C_chainA chain A to P02747 with 0 mismatches
Associated c1q_A_chainB chain B to chain I with 16 mismatches
Associated c1q_B_chainB chain B to chain I with 16 mismatches
Associated c1q_C_chainB chain B to P02747 with 0 mismatches
Associated c1q_A_chainC chain C to chain I with 16 mismatches
Associated c1q_B_chainC chain C to chain I with 16 mismatches
Associated c1q_C_chainC chain C to P02747 with 0 mismatches
Associated c1q_A_chainD chain D to chain I with 16 mismatches
Associated c1q_B_chainD chain D to chain I with 16 mismatches
Associated c1q_C_chainD chain D to P02747 with 0 mismatches
Associated c1q_A_chainE chain E to chain I with 16 mismatches
Associated c1q_B_chainE chain E to chain I with 16 mismatches
Associated c1q_C_chainE chain E to P02747 with 0 mismatches
Associated 64.pdb chain I to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: J3XUW9JZSBPRSGYN
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_C_n_term.pdb models
> #17 relModel #1
> close #17
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/65.pdb
Chain information for 65.pdb #17
---
Chain | Description
J | No description available
> sequence align P02745,#17/J
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain J with 0 mismatches
Associated c1q_A_chainA chain A to P02745 with 0 mismatches
Associated c1q_B_chainA chain A to chain J with 11 mismatches
Associated c1q_C_chainA chain A to chain J with 10 mismatches
Associated c1q_A_chainB chain B to P02745 with 0 mismatches
Associated c1q_B_chainB chain B to chain J with 11 mismatches
Associated c1q_C_chainB chain B to chain J with 10 mismatches
Associated c1q_A_chainC chain C to P02745 with 0 mismatches
Associated c1q_B_chainC chain C to chain J with 11 mismatches
Associated c1q_C_chainC chain C to chain J with 10 mismatches
Associated c1q_A_chainD chain D to P02745 with 0 mismatches
Associated c1q_B_chainD chain D to chain J with 11 mismatches
Associated c1q_C_chainD chain D to chain J with 10 mismatches
Associated c1q_A_chainE chain E to P02745 with 0 mismatches
Associated c1q_B_chainE chain E to chain J with 11 mismatches
Associated c1q_C_chainE chain E to chain J with 10 mismatches
Associated 65.pdb chain J to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: K6Q2DE2G5YOGEKX8
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_A_collagen_pre.pdb
> models #17 relModel #1
> close #17
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/66.pdb
Chain information for 66.pdb #17
---
Chain | Description
J | No description available
> sequence align P02746,#17/J
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain J with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain J with 11 mismatches
Associated c1q_A_chainA chain A to chain J with 11 mismatches
Associated c1q_B_chainA chain A to P02746 with 0 mismatches
Associated c1q_C_chainA chain A to chain J with 10 mismatches
Associated c1q_A_chainB chain B to chain J with 11 mismatches
Associated c1q_B_chainB chain B to P02746 with 0 mismatches
Associated c1q_C_chainB chain B to chain J with 10 mismatches
Associated c1q_A_chainC chain C to chain J with 11 mismatches
Associated c1q_B_chainC chain C to P02746 with 0 mismatches
Associated c1q_C_chainC chain C to chain J with 10 mismatches
Associated c1q_A_chainD chain D to chain J with 11 mismatches
Associated c1q_B_chainD chain D to P02746 with 0 mismatches
Associated c1q_C_chainD chain D to chain J with 10 mismatches
Associated c1q_A_chainE chain E to chain J with 11 mismatches
Associated c1q_B_chainE chain E to P02746 with 0 mismatches
Associated c1q_C_chainE chain E to chain J with 10 mismatches
Associated 66.pdb chain J to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: M731QKA74F9Q6DK6
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_B_collagen_pre.pdb
> models #17 relModel #1
> close #17
> sequence align P02747,#17/J
Missing or invalid "seqSource" argument: Expected alignment-id or sequences
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/67.pdb
Chain information for 67.pdb #17
---
Chain | Description
J | No description available
> sequence align P02747,#17/J
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain J with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain J with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain J with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain J with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain J with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain J with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain J with 10 mismatches
Associated c1q_A_chainA chain A to chain J with 10 mismatches
Associated c1q_B_chainA chain A to chain J with 10 mismatches
Associated c1q_C_chainA chain A to P02747 with 0 mismatches
Associated c1q_A_chainB chain B to chain J with 10 mismatches
Associated c1q_B_chainB chain B to chain J with 10 mismatches
Associated c1q_C_chainB chain B to P02747 with 0 mismatches
Associated c1q_A_chainC chain C to chain J with 10 mismatches
Associated c1q_B_chainC chain C to chain J with 10 mismatches
Associated c1q_C_chainC chain C to P02747 with 0 mismatches
Associated c1q_A_chainD chain D to chain J with 10 mismatches
Associated c1q_B_chainD chain D to chain J with 10 mismatches
Associated c1q_C_chainD chain D to P02747 with 0 mismatches
Associated c1q_A_chainE chain E to chain J with 10 mismatches
Associated c1q_B_chainE chain E to chain J with 10 mismatches
Associated c1q_C_chainE chain E to P02747 with 0 mismatches
Associated 67.pdb chain J to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: GH6QPK9HSGRQSQ10
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_C_collagen_pre.pdb
> models #17 relModel #1
> close #17
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/68.pdb
Chain information for 68.pdb #17
---
Chain | Description
K | No description available
> sequence align P02745,#17/K
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain A to chain K with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain K with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain K with 8 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain K with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain K with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain K with 0 mismatches
Associated c1q_A_chainA chain A to P02745 with 0 mismatches
Associated c1q_A_chainB chain B to P02745 with 0 mismatches
Associated c1q_A_chainC chain C to P02745 with 0 mismatches
Associated c1q_A_chainD chain D to P02745 with 0 mismatches
Associated c1q_A_chainE chain E to P02745 with 0 mismatches
Associated 68.pdb chain K to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: VXE2J6F0OMR8P6X7
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_A_collagen_post.pdb
> models #17 relModel #1
> close #17
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/69.pdb
Chain information for 69.pdb #17
---
Chain | Description
K | No description available
> sequence align P02746,#17/K
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain K with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain K with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain K with 11 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain K with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain K with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain K with 9 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain K with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain K with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain K with 0 mismatches
Associated c1q_B_chainA chain A to P02746 with 0 mismatches
Associated c1q_C_chainA chain A to chain K with 10 mismatches
Associated c1q_B_chainB chain B to P02746 with 0 mismatches
Associated c1q_C_chainB chain B to chain K with 10 mismatches
Associated c1q_B_chainC chain C to P02746 with 0 mismatches
Associated c1q_C_chainC chain C to chain K with 10 mismatches
Associated c1q_B_chainD chain D to P02746 with 0 mismatches
Associated c1q_C_chainD chain D to chain K with 10 mismatches
Associated c1q_B_chainE chain E to P02746 with 0 mismatches
Associated c1q_C_chainE chain E to chain K with 10 mismatches
Associated 69.pdb chain K to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: Z8MZP67ZA0GUW2M8
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_B_collagen_post.pdb
> models #17 relModel #1
> close #17
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/70.pdb
Chain information for 70.pdb #17
---
Chain | Description
K | No description available
> sequence align P02747,#17/K
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain A to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain E to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain I to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain B to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain F to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain J to chain K with 10 mismatches
Associated SASDB38_fit3_model1.pdb chain C to chain K with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain G to chain K with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain K to chain K with 0 mismatches
Associated c1q_B_chainA chain A to chain K with 11 mismatches
Associated c1q_C_chainA chain A to P02747 with 0 mismatches
Associated c1q_B_chainB chain B to chain K with 11 mismatches
Associated c1q_C_chainB chain B to P02747 with 0 mismatches
Associated c1q_B_chainC chain C to chain K with 11 mismatches
Associated c1q_C_chainC chain C to P02747 with 0 mismatches
Associated c1q_B_chainD chain D to chain K with 11 mismatches
Associated c1q_C_chainD chain D to P02747 with 0 mismatches
Associated c1q_B_chainE chain E to chain K with 11 mismatches
Associated c1q_C_chainE chain E to P02747 with 0 mismatches
Associated 70.pdb chain K to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 6K7U2FZD147KX4MX
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_C_collagen_post.pdb
> models #17 relModel #1
> close #17
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/71.pdb
Chain information for 71.pdb #17
---
Chain | Description
L | No description available
> sequence align P02745,#17/L
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to P02745 with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to P02745 with 0 mismatches
Associated c1q_A_chainA chain A to P02745 with 0 mismatches
Associated c1q_A_chainB chain B to P02745 with 0 mismatches
Associated c1q_A_chainC chain C to P02745 with 0 mismatches
Associated c1q_A_chainD chain D to P02745 with 0 mismatches
Associated c1q_A_chainE chain E to P02745 with 0 mismatches
Associated 71.pdb chain L to P02745 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: DTYERNHIJ2SJRGFQ
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_A_collagen_c_term.pdb
> models #17 relModel #1
> close #17
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/72.pdb
Chain information for 72.pdb #17
---
Chain | Description
L | No description available
> sequence align P02746,#17/L
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain L with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain L with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain L with 0 mismatches
Associated c1q_B_chainA chain A to P02746 with 0 mismatches
Associated c1q_B_chainB chain B to P02746 with 0 mismatches
Associated c1q_B_chainC chain C to P02746 with 0 mismatches
Associated c1q_B_chainD chain D to P02746 with 0 mismatches
Associated c1q_B_chainE chain E to P02746 with 0 mismatches
Associated 72.pdb chain L to P02746 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: W6RXMDQZ1ID7W8KD
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_B_collagen_c_term.pdb
> models #17 relModel #1
> close #17
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/73.pdb
Chain information for 73.pdb #17
---
Chain | Description
L | No description available
> sequence align P02747,#17/L
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain D to chain L with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain H to chain L with 0 mismatches
Associated SASDB38_fit3_model1.pdb chain L to chain L with 0 mismatches
Associated c1q_C_chainA chain A to P02747 with 0 mismatches
Associated c1q_C_chainB chain B to P02747 with 0 mismatches
Associated c1q_C_chainC chain C to P02747 with 0 mismatches
Associated c1q_C_chainD chain D to P02747 with 0 mismatches
Associated c1q_C_chainE chain E to P02747 with 0 mismatches
Associated 73.pdb chain L to P02747 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: ZT21SOKZ05ZIY8KC
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_C_collagen_c_term.pdb
> models #17 relModel #1
> close #17
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_A_n_term.pdb
Chain information for c1q_A_n_term.pdb #17
---
Chain | Description
I | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_A_collagen_pre.pdb
Chain information for c1q_A_collagen_pre.pdb #18
---
Chain | Description
J | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_A_collagen_post.pdb
Chain information for c1q_A_collagen_post.pdb #19
---
Chain | Description
K | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_A_collagen_c_term.pdb
Chain information for c1q_A_collagen_c_term.pdb #20
---
Chain | Description
L | No description available
> combine #17,18,19,20
> select add #21
1570 atoms, 1596 bonds, 213 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel F
Chain IDs of 213 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainF/c1q_A_chainF.pdb models #21
> relModel #1
> close #17-21
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_B_n_term.pdb
Chain information for c1q_B_n_term.pdb #17
---
Chain | Description
I | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_B_collagen_pre.pdb
Chain information for c1q_B_collagen_pre.pdb #18
---
Chain | Description
J | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_B_collagen_post.pdb
Chain information for c1q_B_collagen_post.pdb #19
---
Chain | Description
K | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_B_collagen_c_term.pdb
Chain information for c1q_B_collagen_c_term.pdb #20
---
Chain | Description
L | No description available
> combine #17,18,19,20
> select add #21
1556 atoms, 1585 bonds, 215 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel F
Chain IDs of 215 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainF/c1q_B_chainF.pdb models #21
> relModel #1
> close #17-21
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_C_n_term.pdb
Chain information for c1q_C_n_term.pdb #17
---
Chain | Description
I | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_C_collagen_pre.pdb
Chain information for c1q_C_collagen_pre.pdb #18
---
Chain | Description
J | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_C_collagen_post.pdb
Chain information for c1q_C_collagen_post.pdb #19
---
Chain | Description
K | No description available
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1q_chainF/c1q_C_collagen_c_term.pdb
Chain information for c1q_C_collagen_c_term.pdb #20
---
Chain | Description
L | No description available
> combine #17,18,19,20
> select add #21
1526 atoms, 1560 bonds, 212 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel F
Chain IDs of 212 residues changed
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainF/c1q_C_chainF.pdb models #21
> relModel #1
> close #17-21
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainF/c1q_A_chainF_swissmodel.pdb
c1q_A_chainF_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_A_chainF_swissmodel.pdb #17
---
Chain | Description
A | No description available
> select add #17
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel F
Chain IDs of 220 residues changed
> rename #17 c1q_A_chainF
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1648 atom styles
> color sel white
> select clear
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainF/c1q_B_chainF_swissmodel.pdb
c1q_B_chainF_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_B_chainF_swissmodel.pdb #18
---
Chain | Description
A | No description available
> rename #18 c1q_B_chainF
> select add #18
1448 atoms, 1483 bonds, 192 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel F
Chain IDs of 192 residues changed
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1448 atom styles
> color sel white
> select clear
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1q_chainF/c1q_C_chainF_swissmodel.pdb
c1q_C_chainF_swissmodel.pdb title:
SWISS-MODEL SERVER (https://swissmodel.expasy.org) Untitled Project [more
info...]
Chain information for c1q_C_chainF_swissmodel.pdb #19
---
Chain | Description
A | No description available
> rename #19 c1q_C_chainF
> select add #19
1593 atoms, 1645 bonds, 215 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel F
Chain IDs of 215 residues changed
> hide sel cartoons
> show sel atoms
> style sel sphere
Changed 1593 atom styles
> color sel white
> select clear
> show #!1 models
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/modeling_0010.cxs
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/33.pdb
Chain information for 33.pdb #20
---
Chain | Description
M | No description available
> select add #2
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> select add #5
3296 atoms, 3380 bonds, 440 residues, 2 models selected
> select add #17
4944 atoms, 5070 bonds, 660 residues, 3 models selected
> select add #14
6592 atoms, 6760 bonds, 880 residues, 4 models selected
> select add #11
8240 atoms, 8450 bonds, 1100 residues, 5 models selected
> select add #8
9888 atoms, 10140 bonds, 1320 residues, 6 models selected
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/processed/03/c1q_A.pdb
> selectedOnly true relModel #1
> select subtract #2
8240 atoms, 8450 bonds, 1100 residues, 5 models selected
> select subtract #5
6592 atoms, 6760 bonds, 880 residues, 4 models selected
> select subtract #8
4944 atoms, 5070 bonds, 660 residues, 3 models selected
> select subtract #11
3296 atoms, 3380 bonds, 440 residues, 2 models selected
> select subtract #14
1648 atoms, 1690 bonds, 220 residues, 1 model selected
> select subtract #17
Nothing selected
> select add #3
1448 atoms, 1483 bonds, 192 residues, 1 model selected
> select add #6
2896 atoms, 2966 bonds, 384 residues, 2 models selected
> select add #9
4344 atoms, 4449 bonds, 576 residues, 3 models selected
> select add #12
5792 atoms, 5932 bonds, 768 residues, 4 models selected
> select add #15
7240 atoms, 7415 bonds, 960 residues, 5 models selected
> select add #18
8688 atoms, 8898 bonds, 1152 residues, 6 models selected
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/processed/03/c1q_B.pdb
> selectedOnly true relModel #1
> select subtract #3
7240 atoms, 7415 bonds, 960 residues, 5 models selected
> select clear
> select add #4
1593 atoms, 1645 bonds, 215 residues, 1 model selected
> select add #7
3186 atoms, 3290 bonds, 430 residues, 2 models selected
> select add #10
4779 atoms, 4935 bonds, 645 residues, 3 models selected
> select add #13
6372 atoms, 6580 bonds, 860 residues, 4 models selected
> select add #16
7965 atoms, 8225 bonds, 1075 residues, 5 models selected
> select add #19
9558 atoms, 9870 bonds, 1290 residues, 6 models selected
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/processed/03/c1q_C.pdb
> selectedOnly true relModel #1
> select clear
Fetching compressed P00736 UniProt info from
https://www.uniprot.org/uniprot/P00736.xml
> sequence align P00736,#20/M
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain R to P00736 with 2 mismatches
Associated SASDB38_fit3_model1.pdb chain M to chain M with 0 mismatches
Associated 33.pdb chain M to chain M with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: LF55C53DOZ2861Y5
Fetching compressed P09871 UniProt info from
https://www.uniprot.org/uniprot/P09871.xml
> sequence align P09871,#20/M
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain O to P09871 with 3 mismatches
Associated SASDB38_fit3_model1.pdb chain M to chain M with 0 mismatches
Associated 33.pdb chain M to P09871 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: SH00X07SVJEBKXTG
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1s_chainA/cs_1.pdb models #20
> relModel #1
> close #20
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/34.pdb
Chain information for 34.pdb #20
---
Chain | Description
O | No description available
> close #20
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/35.pdb
Chain information for 35.pdb #20
---
Chain | Description
P | No description available
> close #20
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/36.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/37.pdb
Chain information for 36.pdb #20
---
Chain | Description
Q | No description available
Chain information for 37.pdb #21
---
Chain | Description
R | No description available
> close #20-21
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/74.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/75.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/76.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/77.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/78.pdb
Chain information for 74.pdb #20
---
Chain | Description
M | No description available
Chain information for 75.pdb #21
---
Chain | Description
O | No description available
Chain information for 76.pdb #22
---
Chain | Description
P | No description available
Chain information for 77.pdb #23
---
Chain | Description
Q | No description available
Chain information for 78.pdb #24
---
Chain | Description
R | No description available
> select add #20
2180 atoms, 2243 bonds, 275 residues, 1 model selected
> select add #21
5219 atoms, 5362 bonds, 668 residues, 2 models selected
> select subtract #20
3039 atoms, 3119 bonds, 393 residues, 1 model selected
> close #20,22-24
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/33.pdb
Chain information for 33.pdb #20
---
Chain | Description
M | No description available
> select add #20
5219 atoms, 5362 bonds, 668 residues, 2 models selected
> hide #!1 models
> show #!1 models
> close #21
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/34.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/35.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/36.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/37.pdb
Chain information for 34.pdb #21
---
Chain | Description
O | No description available
Chain information for 35.pdb #22
---
Chain | Description
P | No description available
Chain information for 36.pdb #23
---
Chain | Description
Q | No description available
Chain information for 37.pdb #24
---
Chain | Description
R | No description available
> select add #21
5219 atoms, 5362 bonds, 668 residues, 2 models selected
> close #22-24
> sequence align P09871,#20/M
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain O to P09871 with 3 mismatches
Associated SASDB38_fit3_model1.pdb chain M to chain M with 0 mismatches
Associated 33.pdb chain M to P09871 with 0 mismatches
Associated 34.pdb chain O to P09871 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: 29ZRMCBGJVM8D7Z9
> sequence align P09871,#21/O
Alignment identifier is 2
Associated SASDB38_fit3_model1.pdb chain O to chain O with 0 mismatches
Associated 33.pdb chain M to P09871 with 0 mismatches
Associated 34.pdb chain O to P09871 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 2
Webservices job id: 1NVWD1KG33AL3SJA
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1s_chainA/cs_2.pdb models #21
> relModel #1
> close #20-21
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/74.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-pathway/models/c1/source/temp/75.pdb
Chain information for 74.pdb #20
---
Chain | Description
M | No description available
Chain information for 75.pdb #21
---
Chain | Description
O | No description available
> sequence align P09871,#20/M
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain O to P09871 with 3 mismatches
Associated SASDB38_fit3_model1.pdb chain M to chain M with 0 mismatches
Associated 74.pdb chain M to P09871 with 0 mismatches
Associated 75.pdb chain O to P09871 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: M42Y2R6OJU1NW8SE
> sequence align P09871,#21/O
Alignment identifier is 2
Associated SASDB38_fit3_model1.pdb chain O to chain O with 0 mismatches
Associated 74.pdb chain M to P09871 with 0 mismatches
Associated 75.pdb chain O to P09871 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 2
Webservices job id: Q5DIPJN96UXCOV77
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1s_chainB/c1s_1.pdb models #20
> relModel #1
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1s_chainB/c1s_2.pdb models #21
> relModel #1
> close #20-21
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1s_chainA/c1s_1.pdb
> /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/01_grouped/c1s_chainA/c1s_2.pdb
Chain information for c1s_1.pdb #20
---
Chain | Description
M | No description available
Chain information for c1s_2.pdb #21
---
Chain | Description
O | No description available
> combine #20,21
> select add #22
5219 atoms, 5362 bonds, 668 residues, 1 model selected
> ui tool show "Change Chain IDs"
> changechains sel A
Chain IDs of 668 residues changed
> hide #!1 models
> hide #2 models
> hide #3 models
> hide #4 models
> hide #5-19 target m
> select clear
> ui tool show "Show Sequence Viewer"
> save /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1s_chainA/c1s_chainA.pdb models #22 relModel
> #1
> close #20-22
> open /Users/derekng/Dropbox/data-shared/business/derekng/clients/invivo-
> redNucleus/2023/complement-
> pathway/models/c1/processed/02/c1s_chainA/c1s_chainA.pdb
Summary of feedback from opening /Users/derekng/Dropbox/data-
shared/business/derekng/clients/invivo-redNucleus/2023/complement-
pathway/models/c1/processed/02/c1s_chainA/c1s_chainA.pdb
---
warning | PDB SEQRES record for chain A is incomplete. Ignoring input sequence
records as basis for sequence.
Chain information for c1s_chainA.pdb #20
---
Chain | Description
A | No description available
> ui tool show "Show Sequence Viewer"
> sequence chain #20/A
Alignment identifier is 20/A
> sequence align P09871,#20/A
Alignment identifier is 1
Associated SASDB38_fit3_model1.pdb chain O to chain A with 0 mismatches
Associated c1s_chainA.pdb chain A to P09871 with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Webservices job id: ZJ8P394Y8UX92SL7
> select #20/A:290-291
15 atoms, 15 bonds, 2 residues, 1 model selected
> select #20/A:290-292
23 atoms, 22 bonds, 3 residues, 1 model selected
> select #20/A:281-282
13 atoms, 12 bonds, 2 residues, 1 model selected
> select #20/A:281-292
104 atoms, 107 bonds, 12 residues, 1 model selected
> select #20/A:288
10 atoms, 10 bonds, 1 residue, 1 model selected
> select #20/A:288-297
75 atoms, 77 bonds, 10 residues, 1 model selected
> ui tool show "Model Loops"
> modeller refine 1:1:288-297 numModels 5 fast false adjacentFlexible 1
> protocol standard executableLocation /Library/modeller-10.4/bin/mod10.4
Parameters
---
Chain pairing | ss
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker c1s_chainA.pdb, chain A (#20) with P09871, chain A (#), sequence
alignment score = 3500.2
RMSD between 661 pruned atom pairs is 0.087 angstroms; (across all 668 pairs:
0.863)
Parameters
---
Chain pairing | ss
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker c1s_chainA.pdb, chain A (#20) with P09871, chain A (#), sequence
alignment score = 3493
RMSD between 658 pruned atom pairs is 0.032 angstroms; (across all 668 pairs:
1.404)
Parameters
---
Chain pairing | ss
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker c1s_chainA.pdb, chain A (#20) with P09871, chain A (#), sequence
alignment score = 3507.4
RMSD between 661 pruned atom pairs is 0.079 angstroms; (across all 668 pairs:
0.610)
Parameters
---
Chain pairing | ss
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker c1s_chainA.pdb, chain A (#20) with P09871, chain A (#), sequence
alignment score = 3503.8
RMSD between 659 pruned atom pairs is 0.075 angstroms; (across all 668 pairs:
0.936)
Parameters
---
Chain pairing | ss
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker c1s_chainA.pdb, chain A (#20) with P09871, chain A (#), sequence
alignment score = 3503.8
RMSD between 659 pruned atom pairs is 0.075 angstroms; (across all 668 pairs:
0.546)
Associated P09871 chain A to P09871 with 0 mismatches
[Repeated 4 time(s)]Traceback (most recent call last):
File
"/Applications/ChimeraX-1.7.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/ui/gui.py", line 717, in customEvent
func(*args, **kw)
File
"/Applications/ChimeraX-1.7.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/modeller/common.py", line 784, in process_results
self.caller.process_ok_models(model_info, get_pdb_model)
File
"/Applications/ChimeraX-1.7.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/modeller/common.py", line 455, in process_ok_models
alignment.associate(models, seq=target_seq)
File
"/Applications/ChimeraX-1.7.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/seqalign/alignment.py", line 391, in associate
self._notify_observers(note_name, note_data)
File
"/Applications/ChimeraX-1.7.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/seqalign/alignment.py", line 822, in _notify_observers
recipient.alignment_notification(self.NOTE_MOD_ASSOC, (note_name, note_data))
File
"/Applications/ChimeraX-1.7.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/seq_view/tool.py", line 463, in alignment_notification
self.associations_tool._assoc_mod(note_data)
File
"/Applications/ChimeraX-1.7.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/seq_view/associations_tool.py", line 118, in _assoc_mod
self._set_ss_data()
File
"/Applications/ChimeraX-1.7.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/seq_view/associations_tool.py", line 184, in _set_ss_data
self.ss_chain_list.value = self.sv.alignment.associations.keys()
^^^^^^^^^^^^^^^^^^^^^^^^
File
"/Applications/ChimeraX-1.7.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/atomic/widgets.py", line 91, in value
self.set_value(val)
File
"/Applications/ChimeraX-1.7.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/ui/widgets/item_chooser.py", line 151, in set_value
self._select_value(val)
File
"/Applications/ChimeraX-1.7.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/ui/widgets/item_chooser.py", line 236, in _select_value
val_names = set([self.value_map[v] for v in val])
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
File
"/Applications/ChimeraX-1.7.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/ui/widgets/item_chooser.py", line 236, in <listcomp>
val_names = set([self.value_map[v] for v in val])
~~~~~~~~~~~~~~^^^
KeyError: <chimerax.atomic.molobject.Chain object at 0x377301d50>
KeyError:
File
"/Applications/ChimeraX-1.7.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/ui/widgets/item_chooser.py", line 236, in
val_names = set([self.value_map[v] for v in val])
~~~~~~~~~~~~~~^^^
See log for complete Python traceback.
OpenGL version: 4.1 Metal - 88
OpenGL renderer: Apple M1
OpenGL vendor: Apple
Python: 3.11.2
Locale: UTF-8
Qt version: PyQt6 6.3.1, Qt 6.3.1
Qt runtime version: 6.3.2
Qt platform: cocoa
Hardware:
Hardware Overview:
Model Name: MacBook Pro
Model Identifier: MacBookPro17,1
Model Number: Z11B000ENLL/A
Chip: Apple M1
Total Number of Cores: 8 (4 performance and 4 efficiency)
Memory: 16 GB
System Firmware Version: 10151.61.4
OS Loader Version: 10151.61.4
Software:
System Software Overview:
System Version: macOS 14.2.1 (23C71)
Kernel Version: Darwin 23.2.0
Time since boot: 7 days, 17 hours, 45 minutes
Graphics/Displays:
Apple M1:
Chipset Model: Apple M1
Type: GPU
Bus: Built-In
Total Number of Cores: 8
Vendor: Apple (0x106b)
Metal Support: Metal 3
Displays:
Color LCD:
Display Type: Built-In Retina LCD
Resolution: 2560 x 1600 Retina
Main Display: Yes
Mirror: Off
Online: Yes
Automatically Adjust Brightness: Yes
Connection Type: Internal
Installed Packages:
alabaster: 0.7.13
appdirs: 1.4.4
appnope: 0.1.3
asttokens: 2.4.1
Babel: 2.14.0
backcall: 0.2.0
beautifulsoup4: 4.11.2
blockdiag: 3.0.0
blosc2: 2.0.0
build: 0.10.0
certifi: 2022.12.7
cftime: 1.6.3
charset-normalizer: 3.3.2
ChimeraX-AddCharge: 1.5.13
ChimeraX-AddH: 2.2.5
ChimeraX-AlignmentAlgorithms: 2.0.1
ChimeraX-AlignmentHdrs: 3.4.1
ChimeraX-AlignmentMatrices: 2.1
ChimeraX-Alignments: 2.12.1
ChimeraX-AlphaFold: 1.0
ChimeraX-AltlocExplorer: 1.1.1
ChimeraX-AmberInfo: 1.0
ChimeraX-Arrays: 1.1
ChimeraX-Atomic: 1.49.1
ChimeraX-AtomicLibrary: 12.1.3
ChimeraX-AtomSearch: 2.0.1
ChimeraX-AxesPlanes: 2.3.2
ChimeraX-BasicActions: 1.1.2
ChimeraX-BILD: 1.0
ChimeraX-BlastProtein: 2.1.2
ChimeraX-BondRot: 2.0.4
ChimeraX-BugReporter: 1.0.1
ChimeraX-BuildStructure: 2.10.5
ChimeraX-Bumps: 1.0
ChimeraX-BundleBuilder: 1.2.2
ChimeraX-ButtonPanel: 1.0.1
ChimeraX-CageBuilder: 1.0.1
ChimeraX-CellPack: 1.0
ChimeraX-Centroids: 1.3.2
ChimeraX-ChangeChains: 1.1
ChimeraX-CheckWaters: 1.3.2
ChimeraX-ChemGroup: 2.0.1
ChimeraX-Clashes: 2.2.4
ChimeraX-ColorActions: 1.0.3
ChimeraX-ColorGlobe: 1.0
ChimeraX-ColorKey: 1.5.5
ChimeraX-CommandLine: 1.2.5
ChimeraX-ConnectStructure: 2.0.1
ChimeraX-Contacts: 1.0.1
ChimeraX-Core: 1.7
ChimeraX-CoreFormats: 1.2
ChimeraX-coulombic: 1.4.2
ChimeraX-Crosslinks: 1.0
ChimeraX-Crystal: 1.0
ChimeraX-CrystalContacts: 1.0.1
ChimeraX-DataFormats: 1.2.3
ChimeraX-Dicom: 1.2
ChimeraX-DistMonitor: 1.4
ChimeraX-DockPrep: 1.1.3
ChimeraX-Dssp: 2.0
ChimeraX-EMDB-SFF: 1.0
ChimeraX-ESMFold: 1.0
ChimeraX-FileHistory: 1.0.1
ChimeraX-FunctionKey: 1.0.1
ChimeraX-Geometry: 1.3
ChimeraX-gltf: 1.0
ChimeraX-Graphics: 1.1.1
ChimeraX-Hbonds: 2.4
ChimeraX-Help: 1.2.2
ChimeraX-HKCage: 1.3
ChimeraX-IHM: 1.1
ChimeraX-ImageFormats: 1.2
ChimeraX-IMOD: 1.0
ChimeraX-IO: 1.0.1
ChimeraX-ItemsInspection: 1.0.1
ChimeraX-IUPAC: 1.0
ChimeraX-Label: 1.1.8
ChimeraX-ListInfo: 1.2.2
ChimeraX-Log: 1.1.6
ChimeraX-LookingGlass: 1.1
ChimeraX-Maestro: 1.9.1
ChimeraX-Map: 1.1.4
ChimeraX-MapData: 2.0
ChimeraX-MapEraser: 1.0.1
ChimeraX-MapFilter: 2.0.1
ChimeraX-MapFit: 2.0
ChimeraX-MapSeries: 2.1.1
ChimeraX-Markers: 1.0.1
ChimeraX-Mask: 1.0.2
ChimeraX-MatchMaker: 2.1.2
ChimeraX-MCopy: 1.0
ChimeraX-MDcrds: 2.6
ChimeraX-MedicalToolbar: 1.0.2
ChimeraX-Meeting: 1.0.1
ChimeraX-MLP: 1.1.1
ChimeraX-mmCIF: 2.12.1
ChimeraX-MMTF: 2.2
ChimeraX-Modeller: 1.5.13
ChimeraX-ModelPanel: 1.4
ChimeraX-ModelSeries: 1.0.1
ChimeraX-Mol2: 2.0.3
ChimeraX-Mole: 1.0
ChimeraX-Morph: 1.0.2
ChimeraX-MouseModes: 1.2
ChimeraX-Movie: 1.0
ChimeraX-Neuron: 1.0
ChimeraX-Nifti: 1.1
ChimeraX-NRRD: 1.1
ChimeraX-Nucleotides: 2.0.3
ChimeraX-OpenCommand: 1.13.1
ChimeraX-PDB: 2.7.3
ChimeraX-PDBBio: 1.0.1
ChimeraX-PDBLibrary: 1.0.3
ChimeraX-PDBMatrices: 1.0
ChimeraX-PickBlobs: 1.0.1
ChimeraX-Positions: 1.0
ChimeraX-PresetMgr: 1.1
ChimeraX-PubChem: 2.1
ChimeraX-ReadPbonds: 1.0.1
ChimeraX-Registration: 1.1.2
ChimeraX-RemoteControl: 1.0
ChimeraX-RenderByAttr: 1.1
ChimeraX-RenumberResidues: 1.1
ChimeraX-ResidueFit: 1.0.1
ChimeraX-RestServer: 1.2
ChimeraX-RNALayout: 1.0
ChimeraX-RotamerLibMgr: 4.0
ChimeraX-RotamerLibsDunbrack: 2.0
ChimeraX-RotamerLibsDynameomics: 2.0
ChimeraX-RotamerLibsRichardson: 2.0
ChimeraX-SaveCommand: 1.5.1
ChimeraX-SchemeMgr: 1.0
ChimeraX-SDF: 2.0.2
ChimeraX-Segger: 1.0
ChimeraX-Segment: 1.0.1
ChimeraX-SelInspector: 1.0
ChimeraX-SeqView: 2.11
ChimeraX-Shape: 1.0.1
ChimeraX-Shell: 1.0.1
ChimeraX-Shortcuts: 1.1.1
ChimeraX-ShowSequences: 1.0.2
ChimeraX-SideView: 1.0.1
ChimeraX-Smiles: 2.1.2
ChimeraX-SmoothLines: 1.0
ChimeraX-SpaceNavigator: 1.0
ChimeraX-StdCommands: 1.12.3
ChimeraX-STL: 1.0.1
ChimeraX-Storm: 1.0
ChimeraX-StructMeasure: 1.1.2
ChimeraX-Struts: 1.0.1
ChimeraX-Surface: 1.0.1
ChimeraX-SwapAA: 2.0.1
ChimeraX-SwapRes: 2.2.2
ChimeraX-TapeMeasure: 1.0
ChimeraX-TaskManager: 1.0
ChimeraX-Test: 1.0
ChimeraX-Toolbar: 1.1.2
ChimeraX-ToolshedUtils: 1.2.4
ChimeraX-Topography: 1.0
ChimeraX-ToQuest: 1.0
ChimeraX-Tug: 1.0.1
ChimeraX-UI: 1.33.2
ChimeraX-uniprot: 2.3
ChimeraX-UnitCell: 1.0.1
ChimeraX-ViewDockX: 1.3.2
ChimeraX-VIPERdb: 1.0
ChimeraX-Vive: 1.1
ChimeraX-VolumeMenu: 1.0.1
ChimeraX-vrml: 1.0
ChimeraX-VTK: 1.0
ChimeraX-WavefrontOBJ: 1.0
ChimeraX-WebCam: 1.0.2
ChimeraX-WebServices: 1.1.3
ChimeraX-Zone: 1.0.1
colorama: 0.4.6
comm: 0.2.0
contourpy: 1.2.0
cxservices: 1.2.2
cycler: 0.12.1
Cython: 0.29.33
debugpy: 1.8.0
decorator: 5.1.1
docutils: 0.19
executing: 2.0.1
filelock: 3.9.0
fonttools: 4.47.0
funcparserlib: 2.0.0a0
glfw: 2.6.4
grako: 3.16.5
h5py: 3.10.0
html2text: 2020.1.16
idna: 3.6
ihm: 0.38
imagecodecs: 2023.9.18
imagesize: 1.4.1
ipykernel: 6.23.2
ipython: 8.14.0
ipython-genutils: 0.2.0
ipywidgets: 8.1.1
jedi: 0.18.2
Jinja2: 3.1.2
jupyter-client: 8.2.0
jupyter-core: 5.5.1
jupyterlab-widgets: 3.0.9
kiwisolver: 1.4.5
line-profiler: 4.0.2
lxml: 4.9.2
lz4: 4.3.2
MarkupSafe: 2.1.3
matplotlib: 3.7.2
matplotlib-inline: 0.1.6
msgpack: 1.0.4
nest-asyncio: 1.5.8
netCDF4: 1.6.2
networkx: 3.1
nibabel: 5.0.1
nptyping: 2.5.0
numexpr: 2.8.8
numpy: 1.25.1
openvr: 1.23.701
packaging: 21.3
ParmEd: 3.4.3
parso: 0.8.3
pep517: 0.13.0
pexpect: 4.9.0
pickleshare: 0.7.5
Pillow: 10.0.1
pip: 23.0
pkginfo: 1.9.6
platformdirs: 4.1.0
prompt-toolkit: 3.0.43
psutil: 5.9.5
ptyprocess: 0.7.0
pure-eval: 0.2.2
py-cpuinfo: 9.0.0
pycollada: 0.7.2
pydicom: 2.3.0
Pygments: 2.16.1
pynrrd: 1.0.0
PyOpenGL: 3.1.7
PyOpenGL-accelerate: 3.1.7
pyopenxr: 1.0.2801
pyparsing: 3.0.9
pyproject-hooks: 1.0.0
PyQt6-commercial: 6.3.1
PyQt6-Qt6: 6.3.2
PyQt6-sip: 13.4.0
PyQt6-WebEngine-commercial: 6.3.1
PyQt6-WebEngine-Qt6: 6.3.2
python-dateutil: 2.8.2
pytz: 2023.3.post1
pyzmq: 25.1.2
qtconsole: 5.4.3
QtPy: 2.4.1
RandomWords: 0.4.0
requests: 2.31.0
scipy: 1.11.1
setuptools: 67.4.0
setuptools-scm: 7.0.5
sfftk-rw: 0.7.3
six: 1.16.0
snowballstemmer: 2.2.0
sortedcontainers: 2.4.0
soupsieve: 2.5
sphinx: 6.1.3
sphinx-autodoc-typehints: 1.22
sphinxcontrib-applehelp: 1.0.7
sphinxcontrib-blockdiag: 3.0.0
sphinxcontrib-devhelp: 1.0.5
sphinxcontrib-htmlhelp: 2.0.4
sphinxcontrib-jsmath: 1.0.1
sphinxcontrib-qthelp: 1.0.6
sphinxcontrib-serializinghtml: 1.1.9
stack-data: 0.6.3
superqt: 0.5.0
tables: 3.8.0
tcia-utils: 1.5.1
tifffile: 2023.7.18
tinyarray: 1.2.4
tomli: 2.0.1
tornado: 6.4
traitlets: 5.9.0
typing-extensions: 4.9.0
tzdata: 2023.3
urllib3: 2.1.0
wcwidth: 0.2.12
webcolors: 1.12
wheel: 0.38.4
wheel-filename: 1.4.1
widgetsnbextension: 4.0.9
Change History (2)
comment:1 by , 3 years ago
| Component: | Unassigned → Sequence |
|---|---|
| Owner: | set to |
| Platform: | → all |
| Project: | → ChimeraX |
| Status: | new → accepted |
| Summary: | ChimeraX bug report submission → KeyError in structure-association chain list |
comment:2 by , 3 years ago
| Resolution: | → fixed |
|---|---|
| Status: | accepted → closed |
Fixed in tomorrow's 1.8 daily build, and the upcoming 1.7.1 release, sometime in early January.
Fix: https://github.com/RBVI/ChimeraX/commit/64e0ae991de9eda4e864ec0076de0ad09b679856
Note:
See TracTickets
for help on using tickets.
Hi David,
--Eric