Opened 3 years ago
Closed 2 years ago
#9202 closed defect (duplicate)
MemoryError open mmCIF
| Reported by: | Owned by: | Greg Couch | |
|---|---|---|---|
| Priority: | normal | Milestone: | |
| Component: | Input/Output | Version: | |
| Keywords: | Cc: | ||
| Blocked By: | Blocking: | ||
| Notify when closed: | Platform: | all | |
| Project: | ChimeraX |
Description
The following bug report has been submitted:
Platform: Windows-10-10.0.22621
ChimeraX Version: 1.6.1 (2023-05-09 17:57:07 UTC)
Description
(Describe the actions that caused this problem to occur here)
Log:
UCSF ChimeraX version: 1.6.1 (2023-05-09)
© 2016-2023 Regents of the University of California. All rights reserved.
> open "D:\Promotion\Strukturen\Protein structures\IRED\IRED 246 alphafold
> dimer and 7OG3.cxs" format session
Log from Sat Feb 25 00:17:41 2023UCSF ChimeraX version: 1.5 (2022-11-24)
© 2016-2022 Regents of the University of California. All rights reserved.
How to cite UCSF ChimeraX
> ui tool show AlphaFold
> alphafold predict
> MNSASIPASVTVIGLGHMGVALADAFLKGGHPTTVWNRSADKAKGLVEKGAVLAGSVSEAIAASSLVVVCLSTYKVMQELLAPLENELSGRVIVNLTTGTPEDARKTAKWVIEHGGQYLDGAIMAIPQMIGLPETLIFYGGSKALFEAYEPTLKLLGGNAAYLGEDYGVPLIYDLSLLTMMYGAWYGSMHAHALLSTANITGTEFLPYATNWVNHLIAPLLTDPVAARARDEGNFTTDVSNLNTNKLGLEHIIHASQEQGITVEWLMPLLTLATQKVAEGYGADSFDRVIEAIRKPRVK,MNSASIPASVTVIGLGHMGVALADAFLKGGHPTTVWNRSADKAKGLVEKGAVLAGSVSEAIAASSLVVVCLSTYKVMQELLAPLENELSGRVIVNLTTGTPEDARKTAKWVIEHGGQYLDGAIMAIPQMIGLPETLIFYGGSKALFEAYEPTLKLLGGNAAYLGEDYGVPLIYDLSLLTMMYGAWYGSMHAHALLSTANITGTEFLPYATNWVNHLIAPLLTDPVAARARDEGNFTTDVSNLNTNKLGLEHIIHASQEQGITVEWLMPLLTLATQKVAEGYGADSFDRVIEAIRKPRVK
Please cite ColabFold: Making protein folding accessible to all. Nature
Methods (2022) if you use these predictions.
Running AlphaFold prediction
AlphaFold prediction finished
Results in C:\Users\Alex/Downloads/ChimeraX/AlphaFold/prediction_2
> open C:\Users\Alex/Downloads/ChimeraX/AlphaFold/prediction_2\best_model.pdb
Chain information for best_model.pdb #1
---
Chain | Description
B C | No description available
> save "D:/Promotion/Strukturen/Protein structures/IRED/IRED 246 alphafold
> dimer.cxs"
> open 7OG3
7og3 title:
Ired-88 [more info...]
Chain information for 7og3 #2
---
Chain | Description | UniProt
A B | NAD(P)-dependent oxidoreductase | A0A5P2XKZ4_STRST
Non-standard residues in 7og3 #2
---
NA — sodium ion
NDP — nadph dihydro-nicotinamide-adenine-dinucleotide phosphate
> matchmaker #2 to #1
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker best_model.pdb, chain B (#1) with 7og3, chain A (#2), sequence
alignment score = 810
RMSD between 179 pruned atom pairs is 0.929 angstroms; (across all 290 pairs:
3.461)
> hide #!2 models
> show #!2 models
> hide #1 models
> show #1 models
> hide #!2 models
> show #!2 models
> close #2
> open 5OCM
Summary of feedback from opening 5OCM fetched from pdb
---
notes | Fetching compressed mmCIF 5ocm from
http://files.rcsb.org/download/5ocm.cif
Fetching CCD NAP from http://ligand-expo.rcsb.org/reports/N/NAP/NAP.cif
Fetching CCD 9RH from http://ligand-expo.rcsb.org/reports/9/9RH/9RH.cif
Fetching CCD MG from http://ligand-expo.rcsb.org/reports/M/MG/MG.cif
5ocm title:
Imine Reductase from Streptosporangium roseum in complex with NADP+ and
2,2,2-trifluoroacetophenone hydrate [more info...]
Chain information for 5ocm #2
---
Chain | Description | UniProt
A B C D E F | NAD_Gly3P_dh, NAD-dependent glycerol-3-phosphate dehydrogenase |
D2B7Z8_STRRD
Non-standard residues in 5ocm #2
---
9RH — 2,2,2-trifluoromethyl acetophenone hydrate
MG — magnesium ion
NAP — nadp nicotinamide-adenine-dinucleotide phosphate
(2'-monophosphoadenosine 5'-diphosphoribose)
5ocm mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
3| author_and_software_defined_assembly
> undo
[Repeated 2 time(s)]
> show #1 models
> close #2
> open 5OCM
5ocm title:
Imine Reductase from Streptosporangium roseum in complex with NADP+ and
2,2,2-trifluoroacetophenone hydrate [more info...]
Chain information for 5ocm #2
---
Chain | Description | UniProt
A B C D E F | NAD_Gly3P_dh, NAD-dependent glycerol-3-phosphate dehydrogenase |
D2B7Z8_STRRD
Non-standard residues in 5ocm #2
---
9RH — 2,2,2-trifluoromethyl acetophenone hydrate
MG — magnesium ion
NAP — nadp nicotinamide-adenine-dinucleotide phosphate
(2'-monophosphoadenosine 5'-diphosphoribose)
5ocm mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
3| author_and_software_defined_assembly
> style sphere
Changed 18457 atom styles
> style sphere
Changed 18457 atom styles
> style sphere
Changed 18457 atom styles
> undo
[Repeated 3 time(s)]
> show #1 models
> show cartoons
> matchmaker #2 to #1
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker best_model.pdb, chain B (#1) with 5ocm, chain A (#2), sequence
alignment score = 810.4
RMSD between 158 pruned atom pairs is 0.757 angstroms; (across all 290 pairs:
4.259)
> hide #1 models
> style #!2 sphere
Changed 13955 atom styles
> style #!2 sphere
Changed 13955 atom styles
> undo
[Repeated 1 time(s)]
> hide #!2 cartoons
> show #!2 cartoons
> hide #!2 atoms
> show #1 models
> hide #1 models
> close #2
> show #1 models
> open "D:/Promotion/Strukturen/Protein structures/IRED/5ocm.cif.gz"
File reader requires uncompressed file; 'D:/Promotion/Strukturen/Protein
structures/IRED/5ocm.cif.gz' is compressed
> open "D:/Promotion/Strukturen/Protein structures/IRED/5ocm.cif"
5ocm.cif title:
Imine Reductase from Streptosporangium roseum in complex with NADP+ and
2,2,2-trifluoroacetophenone hydrate [more info...]
Chain information for 5ocm.cif #2
---
Chain | Description | UniProt
A B C D E F | NAD_Gly3P_dh, NAD-dependent glycerol-3-phosphate dehydrogenase |
D2B7Z8_STRRD
Non-standard residues in 5ocm.cif #2
---
9RH — 2,2,2-trifluoromethyl acetophenone hydrate
MG — magnesium ion
NAP — nadp nicotinamide-adenine-dinucleotide phosphate
(2'-monophosphoadenosine 5'-diphosphoribose)
5ocm.cif mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
3| author_and_software_defined_assembly
> close #2
> open 7OG3
7og3 title:
Ired-88 [more info...]
Chain information for 7og3 #2
---
Chain | Description | UniProt
A B | NAD(P)-dependent oxidoreductase | A0A5P2XKZ4_STRST
Non-standard residues in 7og3 #2
---
NA — sodium ion
NDP — nadph dihydro-nicotinamide-adenine-dinucleotide phosphate
> matchmaker #2 to #1
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker best_model.pdb, chain B (#1) with 7og3, chain A (#2), sequence
alignment score = 810
RMSD between 179 pruned atom pairs is 0.929 angstroms; (across all 290 pairs:
3.461)
> hide #1 models
> show #1 models
> hide #1 models
> show #1 models
> hide #!2 models
> show #!2 models
> hide #1 models
> ui tool show "Blast Protein"
> hide #!2 models
> show #1 models
> ui tool show "Blast Protein"
> show #!2 models
> view #1 clip false
> log metadata #1
The model has no metadata
> log chains #1
Chain information for best_model.pdb #1
---
Chain | Description
B C | No description available
> show #1 target m
> hide #!2 models
> blastprotein #1/B database pdb cutoff 1e-5 matrix BLOSUM62 maxSeqs 100 name
> bp1
Webservices job id: 85PNHOPZSC9MVKFL
Alignment identifier is bp1 [1]
Associated best_model.pdb chain B to #1/B with 0 mismatches
Associated best_model.pdb chain C to #1/B with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment bp1 [1]
> open pdb:7OSN
Summary of feedback from opening 7OSN fetched from pdb
---
note | Fetching compressed mmCIF 7osn from
http://files.rcsb.org/download/7osn.cif
7osn title:
IRED361 from Micromonospora sp. in complex with NADP+ [more info...]
Chain information for 7osn #3
---
Chain | Description | UniProt
A B C D E F | 6-phosphogluconate dehydrogenase | A0A1S8Y2S4_9ACTN
Non-standard residues in 7osn #3
---
NAP — nadp nicotinamide-adenine-dinucleotide phosphate
(2'-monophosphoadenosine 5'-diphosphoribose)
7osn mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
3| author_and_software_defined_assembly
Associated 7osn chain A to 7OSN_A with 0 mismatches
Associated 7osn chain B to 7OSN_A with 0 mismatches
Associated 7osn chain C to 7OSN_A with 0 mismatches
Associated 7osn chain D to 7OSN_A with 0 mismatches
Associated 7osn chain E to 7OSN_A with 0 mismatches
Associated 7osn chain F to 7OSN_A with 0 mismatches
> matchmaker #3/A to #1/B
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker best_model.pdb, chain B (#1) with 7osn, chain A (#3), sequence
alignment score = 847
RMSD between 153 pruned atom pairs is 0.823 angstroms; (across all 289 pairs:
3.160)
> hide #1,3 atoms
> show #1,3 atoms
> hide #1,3 cartoons
> show #1,3 cartoons
> style #1,3 stick
Changed 17465 atom styles
> undo
[Repeated 3 time(s)]
> style #1,3 stick
Changed 17465 atom styles
> hide #3 models
> close #3
> style #1 stick
Changed 4502 atom styles
> show #1 cartoons
> hide #1 cartoons
> show #1 cartoons
> style #1 stick
Changed 4502 atom styles
> show #1 atoms
> show #!2 models
> hide #!2 models
> color #1 byhetero
> show #!2 models
> hide #!2 models
> view #1 clip false
> undo
[Repeated 6 time(s)]
> ui tool show "Show Sequence Viewer"
> show #!2 models
> sequence chain #2/A #2/B
Alignment identifier is 1
> select
> #2/A-B:21-34,44-54,61-68,78-87,89-94,105-120,131-135,147-160,172-201,205-237,245-264,267-283,289-298
2856 atoms, 2888 bonds, 388 residues, 1 model selected
> undo
> save "D:/Promotion/Strukturen/Protein structures/IRED/IRED 246 alphafold
> dimer and 7OG3.cxs"
——— End of log from Sat Feb 25 00:17:41 2023 ———
opened ChimeraX session
> close session
> open 1K7D format mmcif fromDatabase pdb
Traceback (most recent call last):
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 320, in interceptRequest
self._callback(info)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 93, in _intercept
return interceptor(request_info, *args)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 353, in intercept
chimerax_intercept(*args, view=view, session=session)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 455, in chimerax_intercept
session.ui.thread_safe(defer, session, qurl.url(no_formatting), from_dir)
File "C:\Program Files\ChimeraX\bin\lib\site-packages\chimerax\ui\gui.py",
line 368, in thread_safe
func(*args, **kw)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 446, in defer
cxcmd(session, topic)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 464, in cxcmd
run(session, cmd)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\run.py", line 38, in run
results = command.run(text, log=log, return_json=return_json)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\cli.py", line 2897, in run
result = ci.function(session, **kw_args)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 119, in cmd_open
models = Command(session, registry=registry).run(provider_cmd_text,
log=log)[0]
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\cli.py", line 2897, in run
result = ci.function(session, **kw_args)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 154, in provider_open
models, status = collated_open(session, database_name, ident,
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 464, in collated_open
return remember_data_format()
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 435, in remember_data_format
models, status = func(*func_args, **func_kw)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\mmcif\\__init__.py", line 97, in fetch
return fetcher(session, ident, ignore_cache=ignore_cache, **kw)
File "src\mmcif.pyx", line 418, in chimerax.mmcif.mmcif.fetch_mmcif
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\manager.py", line 198, in open_data
return provider_open(self.session, [path], _return_status=True,
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 194, in provider_open
models, status = collated_open(session, None, [data], data_format,
_add_models,
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 465, in collated_open
return remember_data_format()
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 435, in remember_data_format
models, status = func(*func_args, **func_kw)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\mmcif\\__init__.py", line 43, in open
return mmcif.open_mmcif(session, data, file_name, **kw)
File "src\mmcif.pyx", line 88, in chimerax.mmcif.mmcif.open_mmcif
MemoryError: not enough memory
MemoryError: not enough memory
File "src\mmcif.pyx", line 88, in chimerax.mmcif.mmcif.open_mmcif
See log for complete Python traceback.
> open 1GKF
Summary of feedback from opening 1GKF fetched from pdb
---
note | Fetching compressed mmCIF 1gkf from
http://files.rcsb.org/download/1gkf.cif
Traceback (most recent call last):
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\cmd_line\tool.py", line 319, in execute
cmd.run(cmd_text)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\cli.py", line 2897, in run
result = ci.function(session, **kw_args)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 119, in cmd_open
models = Command(session, registry=registry).run(provider_cmd_text,
log=log)[0]
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\cli.py", line 2897, in run
result = ci.function(session, **kw_args)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 154, in provider_open
models, status = collated_open(session, database_name, ident,
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 464, in collated_open
return remember_data_format()
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 435, in remember_data_format
models, status = func(*func_args, **func_kw)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\mmcif\\__init__.py", line 97, in fetch
return fetcher(session, ident, ignore_cache=ignore_cache, **kw)
File "src\mmcif.pyx", line 418, in chimerax.mmcif.mmcif.fetch_mmcif
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\manager.py", line 198, in open_data
return provider_open(self.session, [path], _return_status=True,
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 194, in provider_open
models, status = collated_open(session, None, [data], data_format,
_add_models,
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 465, in collated_open
return remember_data_format()
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 435, in remember_data_format
models, status = func(*func_args, **func_kw)
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\mmcif\\__init__.py", line 43, in open
return mmcif.open_mmcif(session, data, file_name, **kw)
File "src\mmcif.pyx", line 88, in chimerax.mmcif.mmcif.open_mmcif
MemoryError: not enough memory
MemoryError: not enough memory
File "src\mmcif.pyx", line 88, in chimerax.mmcif.mmcif.open_mmcif
See log for complete Python traceback.
OpenGL version: 3.3.0 NVIDIA 471.68
OpenGL renderer: NVIDIA GeForce GTX 1050/PCIe/SSE2
OpenGL vendor: NVIDIA Corporation
Python: 3.9.11
Locale: de_DE.cp1252
Qt version: PyQt6 6.4.2, Qt 6.4.2
Qt runtime version: 6.4.3
Qt platform: windows
Manufacturer: LENOVO
Model: 81FL
OS: Microsoft Windows 11 Home (Build 22621)
Memory: 8,458,129,408
MaxProcessMemory: 137,438,953,344
CPU: 8 Intel(R) Core(TM) i5-8300H CPU @ 2.30GHz
OSLanguage: de-DE
Installed Packages:
alabaster: 0.7.13
appdirs: 1.4.4
asttokens: 2.2.1
Babel: 2.12.1
backcall: 0.2.0
beautifulsoup4: 4.11.2
blockdiag: 3.0.0
build: 0.10.0
certifi: 2023.5.7
cftime: 1.6.2
charset-normalizer: 3.1.0
ChimeraX-AddCharge: 1.5.9.1
ChimeraX-AddH: 2.2.5
ChimeraX-AlignmentAlgorithms: 2.0.1
ChimeraX-AlignmentHdrs: 3.3.1
ChimeraX-AlignmentMatrices: 2.1
ChimeraX-Alignments: 2.9.3
ChimeraX-AlphaFold: 1.0
ChimeraX-AltlocExplorer: 1.0.3
ChimeraX-AmberInfo: 1.0
ChimeraX-Arrays: 1.1
ChimeraX-Atomic: 1.43.10
ChimeraX-AtomicLibrary: 10.0.6
ChimeraX-AtomSearch: 2.0.1
ChimeraX-AxesPlanes: 2.3.2
ChimeraX-BasicActions: 1.1.2
ChimeraX-BILD: 1.0
ChimeraX-BlastProtein: 2.1.2
ChimeraX-BondRot: 2.0.1
ChimeraX-BugReporter: 1.0.1
ChimeraX-BuildStructure: 2.8
ChimeraX-Bumps: 1.0
ChimeraX-BundleBuilder: 1.2.2
ChimeraX-ButtonPanel: 1.0.1
ChimeraX-CageBuilder: 1.0.1
ChimeraX-CellPack: 1.0
ChimeraX-Centroids: 1.3.2
ChimeraX-ChangeChains: 1.0.2
ChimeraX-CheckWaters: 1.3.1
ChimeraX-ChemGroup: 2.0.1
ChimeraX-Clashes: 2.2.4
ChimeraX-ColorActions: 1.0.3
ChimeraX-ColorGlobe: 1.0
ChimeraX-ColorKey: 1.5.3
ChimeraX-CommandLine: 1.2.5
ChimeraX-ConnectStructure: 2.0.1
ChimeraX-Contacts: 1.0.1
ChimeraX-Core: 1.6.1
ChimeraX-CoreFormats: 1.1
ChimeraX-coulombic: 1.4.2
ChimeraX-Crosslinks: 1.0
ChimeraX-Crystal: 1.0
ChimeraX-CrystalContacts: 1.0.1
ChimeraX-DataFormats: 1.2.3
ChimeraX-Dicom: 1.2
ChimeraX-DistMonitor: 1.4
ChimeraX-DockPrep: 1.1.1
ChimeraX-Dssp: 2.0
ChimeraX-EMDB-SFF: 1.0
ChimeraX-ESMFold: 1.0
ChimeraX-FileHistory: 1.0.1
ChimeraX-FunctionKey: 1.0.1
ChimeraX-Geometry: 1.3
ChimeraX-gltf: 1.0
ChimeraX-Graphics: 1.1.1
ChimeraX-Hbonds: 2.4
ChimeraX-Help: 1.2.1
ChimeraX-HKCage: 1.3
ChimeraX-IHM: 1.1
ChimeraX-ImageFormats: 1.2
ChimeraX-IMOD: 1.0
ChimeraX-IO: 1.0.1
ChimeraX-ItemsInspection: 1.0.1
ChimeraX-Label: 1.1.7
ChimeraX-ListInfo: 1.1.1
ChimeraX-Log: 1.1.5
ChimeraX-LookingGlass: 1.1
ChimeraX-Maestro: 1.8.2
ChimeraX-Map: 1.1.4
ChimeraX-MapData: 2.0
ChimeraX-MapEraser: 1.0.1
ChimeraX-MapFilter: 2.0.1
ChimeraX-MapFit: 2.0
ChimeraX-MapSeries: 2.1.1
ChimeraX-Markers: 1.0.1
ChimeraX-Mask: 1.0.2
ChimeraX-MatchMaker: 2.0.12
ChimeraX-MDcrds: 2.6
ChimeraX-MedicalToolbar: 1.0.2
ChimeraX-Meeting: 1.0.1
ChimeraX-MLP: 1.1.1
ChimeraX-mmCIF: 2.12
ChimeraX-MMTF: 2.2
ChimeraX-Modeller: 1.5.9
ChimeraX-ModelPanel: 1.3.7
ChimeraX-ModelSeries: 1.0.1
ChimeraX-Mol2: 2.0
ChimeraX-Mole: 1.0
ChimeraX-Morph: 1.0.2
ChimeraX-MouseModes: 1.2
ChimeraX-Movie: 1.0
ChimeraX-Neuron: 1.0
ChimeraX-Nifti: 1.0
ChimeraX-NRRD: 1.0
ChimeraX-Nucleotides: 2.0.3
ChimeraX-OpenCommand: 1.10.1
ChimeraX-PDB: 2.7.2
ChimeraX-PDBBio: 1.0
ChimeraX-PDBLibrary: 1.0.2
ChimeraX-PDBMatrices: 1.0
ChimeraX-PickBlobs: 1.0.1
ChimeraX-Positions: 1.0
ChimeraX-PresetMgr: 1.1
ChimeraX-PubChem: 2.1
ChimeraX-ReadPbonds: 1.0.1
ChimeraX-Registration: 1.1.1
ChimeraX-RemoteControl: 1.0
ChimeraX-RenderByAttr: 1.1
ChimeraX-RenumberResidues: 1.1
ChimeraX-ResidueFit: 1.0.1
ChimeraX-RestServer: 1.1
ChimeraX-RNALayout: 1.0
ChimeraX-RotamerLibMgr: 3.0
ChimeraX-RotamerLibsDunbrack: 2.0
ChimeraX-RotamerLibsDynameomics: 2.0
ChimeraX-RotamerLibsRichardson: 2.0
ChimeraX-SaveCommand: 1.5.1
ChimeraX-SchemeMgr: 1.0
ChimeraX-SDF: 2.0.1
ChimeraX-Segger: 1.0
ChimeraX-Segment: 1.0.1
ChimeraX-SelInspector: 1.0
ChimeraX-SeqView: 2.8.3
ChimeraX-Shape: 1.0.1
ChimeraX-Shell: 1.0.1
ChimeraX-Shortcuts: 1.1.1
ChimeraX-ShowSequences: 1.0.1
ChimeraX-SideView: 1.0.1
ChimeraX-Smiles: 2.1
ChimeraX-SmoothLines: 1.0
ChimeraX-SpaceNavigator: 1.0
ChimeraX-StdCommands: 1.10.3
ChimeraX-STL: 1.0.1
ChimeraX-Storm: 1.0
ChimeraX-StructMeasure: 1.1.2
ChimeraX-Struts: 1.0.1
ChimeraX-Surface: 1.0.1
ChimeraX-SwapAA: 2.0.1
ChimeraX-SwapRes: 2.2.1
ChimeraX-TapeMeasure: 1.0
ChimeraX-Test: 1.0
ChimeraX-Toolbar: 1.1.2
ChimeraX-ToolshedUtils: 1.2.1
ChimeraX-Topography: 1.0
ChimeraX-Tug: 1.0.1
ChimeraX-UI: 1.28.4
ChimeraX-uniprot: 2.2.2
ChimeraX-UnitCell: 1.0.1
ChimeraX-ViewDockX: 1.2
ChimeraX-VIPERdb: 1.0
ChimeraX-Vive: 1.1
ChimeraX-VolumeMenu: 1.0.1
ChimeraX-VTK: 1.0
ChimeraX-WavefrontOBJ: 1.0
ChimeraX-WebCam: 1.0.2
ChimeraX-WebServices: 1.1.1
ChimeraX-Zone: 1.0.1
colorama: 0.4.6
comm: 0.1.3
comtypes: 1.1.14
contourpy: 1.0.7
cxservices: 1.2.2
cycler: 0.11.0
Cython: 0.29.33
debugpy: 1.6.7
decorator: 5.1.1
docutils: 0.19
executing: 1.2.0
filelock: 3.9.0
fonttools: 4.39.3
funcparserlib: 1.0.1
grako: 3.16.5
h5py: 3.8.0
html2text: 2020.1.16
idna: 3.4
ihm: 0.35
imagecodecs: 2022.9.26
imagesize: 1.4.1
importlib-metadata: 6.6.0
ipykernel: 6.21.1
ipython: 8.10.0
ipython-genutils: 0.2.0
ipywidgets: 8.0.6
jedi: 0.18.2
Jinja2: 3.1.2
jupyter-client: 8.0.2
jupyter-core: 5.3.0
jupyterlab-widgets: 3.0.7
kiwisolver: 1.4.4
line-profiler: 4.0.2
lxml: 4.9.2
lz4: 4.3.2
MarkupSafe: 2.1.2
matplotlib: 3.6.3
matplotlib-inline: 0.1.6
msgpack: 1.0.4
nest-asyncio: 1.5.6
netCDF4: 1.6.2
networkx: 2.8.8
nibabel: 5.0.1
nptyping: 2.5.0
numexpr: 2.8.4
numpy: 1.23.5
openvr: 1.23.701
packaging: 23.1
ParmEd: 3.4.3
parso: 0.8.3
pep517: 0.13.0
pickleshare: 0.7.5
Pillow: 9.3.0
pip: 23.0
pkginfo: 1.9.6
platformdirs: 3.5.0
prompt-toolkit: 3.0.38
psutil: 5.9.4
pure-eval: 0.2.2
pycollada: 0.7.2
pydicom: 2.3.0
Pygments: 2.14.0
pynrrd: 1.0.0
PyOpenGL: 3.1.5
PyOpenGL-accelerate: 3.1.5
pyparsing: 3.0.9
pyproject-hooks: 1.0.0
PyQt6-commercial: 6.4.2
PyQt6-Qt6: 6.4.3
PyQt6-sip: 13.4.1
PyQt6-WebEngine-commercial: 6.4.0
PyQt6-WebEngine-Qt6: 6.4.3
python-dateutil: 2.8.2
pytz: 2023.3
pywin32: 305
pyzmq: 25.0.2
qtconsole: 5.4.0
QtPy: 2.3.1
RandomWords: 0.4.0
requests: 2.28.2
scipy: 1.9.3
setuptools: 67.4.0
sfftk-rw: 0.7.3
six: 1.16.0
snowballstemmer: 2.2.0
sortedcontainers: 2.4.0
soupsieve: 2.4.1
sphinx: 6.1.3
sphinx-autodoc-typehints: 1.22
sphinxcontrib-applehelp: 1.0.4
sphinxcontrib-blockdiag: 3.0.0
sphinxcontrib-devhelp: 1.0.2
sphinxcontrib-htmlhelp: 2.0.1
sphinxcontrib-jsmath: 1.0.1
sphinxcontrib-qthelp: 1.0.3
sphinxcontrib-serializinghtml: 1.1.5
stack-data: 0.6.2
tables: 3.7.0
tcia-utils: 1.2.0
tifffile: 2022.10.10
tinyarray: 1.2.4
tomli: 2.0.1
tornado: 6.3.1
traitlets: 5.9.0
typing-extensions: 4.5.0
tzdata: 2023.3
urllib3: 1.26.15
wcwidth: 0.2.6
webcolors: 1.12
wheel: 0.38.4
wheel-filename: 1.4.1
widgetsnbextension: 4.0.7
WMI: 1.5.1
zipp: 3.15.0
Change History (2)
comment:1 by , 3 years ago
| Component: | Unassigned → Input/Output |
|---|---|
| Owner: | set to |
| Platform: | → all |
| Project: | → ChimeraX |
| Status: | new → assigned |
| Summary: | ChimeraX bug report submission → MemoryError open mmCIF |
comment:2 by , 2 years ago
| Resolution: | → duplicate |
|---|---|
| Status: | assigned → closed |
Note:
See TracTickets
for help on using tickets.
Duplicated of #8815.