Opened 4 years ago
Last modified 4 years ago
#7743 accepted defect
KeyError in floating-tool dict after de-iconfiy
| Reported by: | Owned by: | Eric Pettersen | |
|---|---|---|---|
| Priority: | normal | Milestone: | |
| Component: | UI | Version: | |
| Keywords: | Cc: | Tom Goddard | |
| Blocked By: | Blocking: | ||
| Notify when closed: | Platform: | all | |
| Project: | ChimeraX |
Description
The following bug report has been submitted:
Platform: macOS-10.16-x86_64-i386-64bit
ChimeraX Version: 1.5.dev202209232318 (2022-09-23 23:18:29 UTC)
Description
(Describe the actions that caused this problem to occur here)
Log:
UCSF ChimeraX version: 1.5.dev202209232318 (2022-09-23)
© 2016-2022 Regents of the University of California. All rights reserved.
How to cite UCSF ChimeraX
> open /Users/daysehuang/Downloads/ChimeraX/PDB/2h4f.cif
2h4f.cif title:
Sir2-p53 peptide-NAD+ [more info...]
Chain information for 2h4f.cif #1
---
Chain | Description | UniProt
A | NAD-dependent deacetylase | NPD_THEMA
D | Cellular tumor antigen p53 | P53_HUMAN
Non-standard residues in 2h4f.cif #1
---
NAD — nicotinamide-adenine-dinucleotide
ZN — zinc ion
> open /Users/daysehuang/Downloads/ChimeraX/PDB/2h4f.cif
2h4f.cif title:
Sir2-p53 peptide-NAD+ [more info...]
Chain information for 2h4f.cif #2
---
Chain | Description | UniProt
A | NAD-dependent deacetylase | NPD_THEMA
D | Cellular tumor antigen p53 | P53_HUMAN
Non-standard residues in 2h4f.cif #2
---
NAD — nicotinamide-adenine-dinucleotide
ZN — zinc ion
> close session
> ui tool show "Modeller Comparative"
> open /Users/daysehuang/Downloads/2KDL.fasta
Summary of feedback from opening /Users/daysehuang/Downloads/2KDL.fasta
---
note | Alignment identifier is 2KDL.fasta
Opened 1 sequences from 2KDL.fasta
> ui tool show "Modeller Comparative"
No alignments chosen for modeling
> open /Users/daysehuang/Downloads/2KDL.fasta
Summary of feedback from opening /Users/daysehuang/Downloads/2KDL.fasta
---
notes | Destroying pre-existing alignment with identifier 2KDL.fasta
Alignment identifier is 2KDL.fasta
Opened 1 sequences from 2KDL.fasta
> ui tool show "Modeller Comparative"
No alignments chosen for modeling
> modeller comparative 2KDL.fasta:1 numModels 5 fast false multichain true
> hetPreserve false hydrogens false waterPreserve false
Alignment 2KDL.fasta has no associated chains
> open /Users/daysehuang/Downloads/2KDL.fasta format fasta
Summary of feedback from opening /Users/daysehuang/Downloads/2KDL.fasta
---
notes | Destroying pre-existing alignment with identifier 2KDL.fasta
Alignment identifier is 2KDL.fasta
Opened 1 sequences from 2KDL.fasta
> ui tool show AlphaFold
Populating font family aliases took 819 ms. Replace uses of missing font
family "Segoe UI" with one that exists to avoid this cost.
> open /Users/daysehuang/Downloads/2KDL.fasta format fasta
Summary of feedback from opening /Users/daysehuang/Downloads/2KDL.fasta
---
notes | Destroying pre-existing alignment with identifier 2KDL.fasta
Alignment identifier is 2KDL.fasta
Opened 1 sequences from 2KDL.fasta
> ui tool show "Modeller Comparative"
> modeller comparative 2KDL.fasta:1 numModels 5 fast false multichain true
> hetPreserve false hydrogens false waterPreserve false
Alignment 2KDL.fasta has no associated chains
> alphafold predict TTYKLILNLKQAKEEAIKELVDAGTAEKYIKLIANAKTVEGVWTLKDEIKTFTVTE
Please cite ColabFold: Making protein folding accessible to all. Nature
Methods (2022) if you use these predictions.
Running AlphaFold prediction
[Repeated 3 time(s)]
> open /Users/daysehuang/Downloads/2KDL-clean.pdb
Chain information for 2KDL-clean.pdb #1
---
Chain | Description
A | No description available
Associated 2KDL-clean.pdb chain A to chain A with 0 mismatches
> color bfactor #1 palette alphafold
919 atoms, 56 residues, atom bfactor range 0 to 0
> undo
Traceback (most recent call last):
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/ui/gui.py", line 614, in changeEvent
self.hide_floating_tools = self.isMinimized()
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/ui/gui.py", line 719, in hide_floating_tools
tw._mw_set_shown(True)
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/ui/gui.py", line 2199, in _mw_set_shown
self.__toolkit.shown = shown
AttributeError: 'NoneType' object has no attribute 'shown'
AttributeError: 'NoneType' object has no attribute 'shown'
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/ui/gui.py", line 2199, in _mw_set_shown
self.__toolkit.shown = shown
See log for complete Python traceback.
AlphaFold prediction finished
Results in /Users/daysehuang/Downloads/ChimeraX/AlphaFold/prediction_1
> open
> /Users/daysehuang/Downloads/ChimeraX/AlphaFold/prediction_1/best_model.pdb
Chain information for best_model.pdb #2
---
Chain | Description
A | No description available
Associated best_model.pdb chain A to chain A with 0 mismatches
> hide #1 models
> Color factor #1 palette alphafold
Unknown command: Color factor #1 palette alphafold
> color factor #1 palette alphafold
Expected a color or one of 'byatom', 'bychain', 'byelement', 'byhetero',
'byidentity', 'bymodel', 'bynucleotide', 'bypolymer', 'fromatoms', or 'random'
or a keyword
> show #1 models
> align #1/A:1-56@CA toAtoms #2/A:1-56@CA
RMSD between 56 atom pairs is 4.544 angstroms
> align #1/A:8-52@CA toAtoms #2/A:8-52@CA
RMSD between 45 atom pairs is 1.302 angstroms
> save "/Users/daysehuang/Downloads/sequence strcuture 2kdl.pdb"
> close session
> open /Users/daysehuang/Downloads/2KDM.fasta
Error processing trigger "new alignment":
RuntimeError: wrapped C/C++ object of type AlignmentListWidget has been
deleted
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/seqalign/widgets.py", line 34, in _items_change
self.alignments_changed.emit(self.session.alignments.alignments)
See log for complete Python traceback.
Summary of feedback from opening /Users/daysehuang/Downloads/2KDM.fasta
---
notes | Alignment identifier is 2KDM.fasta
Traceback (most recent call last):
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/core/triggerset.py", line 134, in invoke
return self._func(self._name, data)
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/seqalign/widgets.py", line 34, in _items_change
self.alignments_changed.emit(self.session.alignments.alignments)
RuntimeError: wrapped C/C++ object of type AlignmentListWidget has been
deleted
Opened 1 sequences from 2KDM.fasta
> open /Users/daysehuang/Downloads/2KDM.fasta format fasta
Error processing trigger "destroy alignment":
RuntimeError: wrapped C/C++ object of type AlignmentListWidget has been
deleted
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/seqalign/widgets.py", line 34, in _items_change
self.alignments_changed.emit(self.session.alignments.alignments)
See log for complete Python traceback.
Error processing trigger "new alignment":
RuntimeError: wrapped C/C++ object of type AlignmentListWidget has been
deleted
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/seqalign/widgets.py", line 34, in _items_change
self.alignments_changed.emit(self.session.alignments.alignments)
See log for complete Python traceback.
Summary of feedback from opening /Users/daysehuang/Downloads/2KDM.fasta
---
notes | Destroying pre-existing alignment with identifier 2KDM.fasta
Traceback (most recent call last):
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/core/triggerset.py", line 134, in invoke
return self._func(self._name, data)
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/seqalign/widgets.py", line 34, in _items_change
self.alignments_changed.emit(self.session.alignments.alignments)
RuntimeError: wrapped C/C++ object of type AlignmentListWidget has been
deleted
Alignment identifier is 2KDM.fasta
Traceback (most recent call last):
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/core/triggerset.py", line 134, in invoke
return self._func(self._name, data)
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/seqalign/widgets.py", line 34, in _items_change
self.alignments_changed.emit(self.session.alignments.alignments)
RuntimeError: wrapped C/C++ object of type AlignmentListWidget has been
deleted
Opened 1 sequences from 2KDM.fasta
> ui tool show AlphaFold
> alphafold predict TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
Running AlphaFold prediction
> alphafold predict TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
Running AlphaFold prediction
AlphaFold prediction finished
Results in /Users/daysehuang/Downloads/ChimeraX/AlphaFold/prediction_2
> open
> /Users/daysehuang/Downloads/ChimeraX/AlphaFold/prediction_2/best_model.pdb
Chain information for best_model.pdb #1
---
Chain | Description
A | No description available
Associated best_model.pdb chain A to chain A with 0 mismatches
AlphaFold prediction finished
Results in /Users/daysehuang/Downloads/ChimeraX/AlphaFold/prediction_2
> open
> /Users/daysehuang/Downloads/ChimeraX/AlphaFold/prediction_2/best_model.pdb
Chain information for best_model.pdb #2
---
Chain | Description
A | No description available
Associated best_model.pdb chain A to chain A with 0 mismatches
> open /Users/daysehuang/Downloads/2KDM-clean.pdb
Chain information for 2KDM-clean.pdb #3
---
Chain | Description
A | No description available
Associated 2KDM-clean.pdb chain A to chain A with 0 mismatches
> ui tool show Matchmaker
> matchmaker #3 to #1
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker best_model.pdb, chain A (#1) with 2KDM-clean.pdb, chain A (#3),
sequence alignment score = 280.1
RMSD between 51 pruned atom pairs is 1.026 angstroms; (across all 56 pairs:
1.307)
> align #1/A:1-56@CA toAtoms #2/A:1-56@CA
RMSD between 56 atom pairs is 0.000 angstroms
Traceback (most recent call last):
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/core/triggerset.py", line 134, in invoke
return self._func(self._name, data)
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/seqalign/widgets.py", line 34, in _items_change
self.alignments_changed.emit(self.session.alignments.alignments)
RuntimeError: wrapped C/C++ object of type AlignmentListWidget has been
deleted
Error processing trigger "destroy alignment":
RuntimeError: wrapped C/C++ object of type AlignmentListWidget has been
deleted
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/seqalign/widgets.py", line 34, in _items_change
self.alignments_changed.emit(self.session.alignments.alignments)
See log for complete Python traceback.
> hide #1 models
> save "/Users/daysehuang/Downloads/sequence 2kdm.pdb"
> close session
> open "/Users/daysehuang/Downloads/sequence strcuture 2kdl.pdb" format pdb
Chain information for sequence strcuture 2kdl.pdb
---
Chain | Description
1.1/A 1.2/A | No description available
> open "/Users/daysehuang/Downloads/sequence strcuture 2kdl.pdb"
Chain information for sequence strcuture 2kdl.pdb
---
Chain | Description
2.1/A 2.2/A | No description available
> close session
> open /Users/daysehuang/Downloads/2KDM-clean.pdb format pdb
Chain information for 2KDM-clean.pdb #1
---
Chain | Description
A | No description available
> open /Users/daysehuang/Downloads/2KDL-clean.pdb
Chain information for 2KDL-clean.pdb #2
---
Chain | Description
A | No description available
> ui tool show Matchmaker
> matchmaker #2 to #1
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker 2KDM-clean.pdb, chain A (#1) with 2KDL-clean.pdb, chain A (#2),
sequence alignment score = 115.3
RMSD between 5 pruned atom pairs is 1.065 angstroms; (across all 56 pairs:
15.446)
> ui tool show Matchmaker
Traceback (most recent call last):
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/core/triggerset.py", line 134, in invoke
return self._func(self._name, data)
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/ui/options/options.py", line 50, in <lambda>
data[0] == pself.attr_name and (setattr(pself, "value", pself.get_attribute())
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/ui/options/options.py", line 312, in set_value
self.widget.setChecked(value)
RuntimeError: wrapped C/C++ object of type QCheckBox has been deleted
Error processing trigger "setting changed":
RuntimeError: wrapped C/C++ object of type QCheckBox has been deleted
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/ui/options/options.py", line 312, in set_value
self.widget.setChecked(value)
See log for complete Python traceback.
> matchmaker #2 to #1 showAlignment true
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker 2KDM-clean.pdb, chain A (#1) with 2KDL-clean.pdb, chain A (#2),
sequence alignment score = 115.3
Alignment identifier is 1
Traceback (most recent call last):
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/core/triggerset.py", line 134, in invoke
return self._func(self._name, data)
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/seqalign/widgets.py", line 34, in _items_change
self.alignments_changed.emit(self.session.alignments.alignments)
RuntimeError: wrapped C/C++ object of type AlignmentListWidget has been
deleted
Error processing trigger "new alignment":
RuntimeError: wrapped C/C++ object of type AlignmentListWidget has been
deleted
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/seqalign/widgets.py", line 34, in _items_change
self.alignments_changed.emit(self.session.alignments.alignments)
See log for complete Python traceback.
Traceback (most recent call last):
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/core/triggerset.py", line 134, in invoke
return self._func(self._name, data)
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/seqalign/widgets.py", line 34, in _items_change
self.alignments_changed.emit(self.session.alignments.alignments)
RuntimeError: wrapped C/C++ object of type AlignmentListWidget has been
deleted
Error processing trigger "destroy alignment":
RuntimeError: wrapped C/C++ object of type AlignmentListWidget has been
deleted
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/seqalign/widgets.py", line 34, in _items_change
self.alignments_changed.emit(self.session.alignments.alignments)
See log for complete Python traceback.
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Traceback (most recent call last):
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/core/triggerset.py", line 134, in invoke
return self._func(self._name, data)
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/seqalign/widgets.py", line 34, in _items_change
self.alignments_changed.emit(self.session.alignments.alignments)
RuntimeError: wrapped C/C++ object of type AlignmentListWidget has been
deleted
Error processing trigger "new alignment":
RuntimeError: wrapped C/C++ object of type AlignmentListWidget has been
deleted
File
"/private/var/folders/5h/mtfx85j94sz_9m0yb9_x38hc0000gn/T/AppTranslocation/DCAC8711-3CC2-4BBC-A5F9-C58686E419B6/d/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/seqalign/widgets.py", line 34, in _items_change
self.alignments_changed.emit(self.session.alignments.alignments)
See log for complete Python traceback.
Hiding conservation header for alignment 1
Chains used in RMSD evaluation for alignment 1: 2KDM-clean.pdb #1/A, 2KDL-
clean.pdb #2/A
Showing rmsd header ("seq_rmsd" residue attribute) for alignment 1
RMSD between 5 pruned atom pairs is 1.065 angstroms; (across all 56 pairs:
15.446)
OpenGL version: 4.1 INTEL-16.5.9
OpenGL renderer: Intel(R) Iris(TM) Plus Graphics 645
OpenGL vendor: Intel Inc.
Python: 3.9.11
Locale: UTF-8
Qt version: PyQt6 6.3.1, Qt 6.3.1
Qt runtime version: 6.3.2
Qt platform: cocoa
Hardware:
Hardware Overview:
Model Name: MacBook Pro
Model Identifier: MacBookPro15,4
Processor Name: Quad-Core Intel Core i5
Processor Speed: 1.4 GHz
Number of Processors: 1
Total Number of Cores: 4
L2 Cache (per Core): 256 KB
L3 Cache: 6 MB
Hyper-Threading Technology: Enabled
Memory: 8 GB
System Firmware Version: 1731.100.130.0.0 (iBridge: 19.16.14243.0.0,0)
Software:
System Software Overview:
System Version: macOS 11.6.5 (20G527)
Kernel Version: Darwin 20.6.0
Time since boot: 1 day 6:23
Graphics/Displays:
Intel Iris Plus Graphics 645:
Chipset Model: Intel Iris Plus Graphics 645
Type: GPU
Bus: Built-In
VRAM (Dynamic, Max): 1536 MB
Vendor: Intel
Device ID: 0x3ea6
Revision ID: 0x0001
Metal Family: Supported, Metal GPUFamily macOS 2
Displays:
Color LCD:
Display Type: Built-In Retina LCD
Resolution: 2560 x 1600 Retina
Framebuffer Depth: 24-Bit Color (ARGB8888)
Main Display: Yes
Mirror: Off
Online: Yes
Automatically Adjust Brightness: Yes
Connection Type: Internal
Installed Packages:
alabaster: 0.7.12
appdirs: 1.4.4
appnope: 0.1.3
asttokens: 2.0.8
Babel: 2.10.3
backcall: 0.2.0
blockdiag: 3.0.0
build: 0.8.0
certifi: 2021.10.8
cftime: 1.6.2
charset-normalizer: 2.1.1
ChimeraX-AddCharge: 1.4
ChimeraX-AddH: 2.2
ChimeraX-AlignmentAlgorithms: 2.0
ChimeraX-AlignmentHdrs: 3.2.1
ChimeraX-AlignmentMatrices: 2.0
ChimeraX-Alignments: 2.6
ChimeraX-AlphaFold: 1.0
ChimeraX-AltlocExplorer: 1.0.3
ChimeraX-AmberInfo: 1.0
ChimeraX-Arrays: 1.0
ChimeraX-Atomic: 1.41.3
ChimeraX-AtomicLibrary: 8.0.1
ChimeraX-AtomSearch: 2.0.1
ChimeraX-AxesPlanes: 2.3
ChimeraX-BasicActions: 1.1.2
ChimeraX-BILD: 1.0
ChimeraX-BlastProtein: 2.1.2
ChimeraX-BondRot: 2.0.1
ChimeraX-BugReporter: 1.0.1
ChimeraX-BuildStructure: 2.7.1
ChimeraX-Bumps: 1.0
ChimeraX-BundleBuilder: 1.2
ChimeraX-ButtonPanel: 1.0.1
ChimeraX-CageBuilder: 1.0.1
ChimeraX-CellPack: 1.0
ChimeraX-Centroids: 1.3.1
ChimeraX-ChangeChains: 1.0.2
ChimeraX-CheckWaters: 1.3
ChimeraX-ChemGroup: 2.0
ChimeraX-Clashes: 2.2.4
ChimeraX-ColorActions: 1.0.2
ChimeraX-ColorGlobe: 1.0
ChimeraX-ColorKey: 1.5.2
ChimeraX-CommandLine: 1.2.4
ChimeraX-ConnectStructure: 2.0.1
ChimeraX-Contacts: 1.0.1
ChimeraX-Core: 1.5.dev202209232318
ChimeraX-CoreFormats: 1.1
ChimeraX-coulombic: 1.3.2
ChimeraX-Crosslinks: 1.0
ChimeraX-Crystal: 1.0
ChimeraX-CrystalContacts: 1.0.1
ChimeraX-DataFormats: 1.2.2
ChimeraX-Dicom: 1.1
ChimeraX-DistMonitor: 1.3
ChimeraX-DockPrep: 1.0
ChimeraX-Dssp: 2.0
ChimeraX-EMDB-SFF: 1.0
ChimeraX-ExperimentalCommands: 1.0
ChimeraX-FileHistory: 1.0.1
ChimeraX-FunctionKey: 1.0.1
ChimeraX-Geometry: 1.2
ChimeraX-gltf: 1.0
ChimeraX-Graphics: 1.1
ChimeraX-Hbonds: 2.4
ChimeraX-Help: 1.2.1
ChimeraX-HKCage: 1.3
ChimeraX-IHM: 1.1
ChimeraX-ImageFormats: 1.2
ChimeraX-IMOD: 1.0
ChimeraX-IO: 1.0.1
ChimeraX-ItemsInspection: 1.0.1
ChimeraX-Label: 1.1.7
ChimeraX-ListInfo: 1.1.1
ChimeraX-Log: 1.1.5
ChimeraX-LookingGlass: 1.1
ChimeraX-Maestro: 1.8.1
ChimeraX-Map: 1.1.1
ChimeraX-MapData: 2.0
ChimeraX-MapEraser: 1.0.1
ChimeraX-MapFilter: 2.0
ChimeraX-MapFit: 2.0
ChimeraX-MapSeries: 2.1.1
ChimeraX-Markers: 1.0.1
ChimeraX-Mask: 1.0.1
ChimeraX-MatchMaker: 2.0.9
ChimeraX-MDcrds: 2.6
ChimeraX-MedicalToolbar: 1.0.2
ChimeraX-Meeting: 1.0.1
ChimeraX-MLP: 1.1
ChimeraX-mmCIF: 2.8
ChimeraX-MMTF: 2.1
ChimeraX-Modeller: 1.5.6
ChimeraX-ModelPanel: 1.3.6
ChimeraX-ModelSeries: 1.0.1
ChimeraX-Mol2: 2.0
ChimeraX-Mole: 1.0
ChimeraX-Morph: 1.0
ChimeraX-MouseModes: 1.1.1
ChimeraX-Movie: 1.0
ChimeraX-Neuron: 1.0
ChimeraX-Nucleotides: 2.0.3
ChimeraX-OpenCommand: 1.9.1
ChimeraX-PDB: 2.6.7
ChimeraX-PDBBio: 1.0
ChimeraX-PDBLibrary: 1.0.2
ChimeraX-PDBMatrices: 1.0
ChimeraX-PickBlobs: 1.0.1
ChimeraX-Positions: 1.0
ChimeraX-PresetMgr: 1.1
ChimeraX-PubChem: 2.1
ChimeraX-ReadPbonds: 1.0.1
ChimeraX-Registration: 1.1.1
ChimeraX-RemoteControl: 1.0
ChimeraX-RenumberResidues: 1.1
ChimeraX-ResidueFit: 1.0.1
ChimeraX-RestServer: 1.1
ChimeraX-RNALayout: 1.0
ChimeraX-RotamerLibMgr: 2.0.1
ChimeraX-RotamerLibsDunbrack: 2.0
ChimeraX-RotamerLibsDynameomics: 2.0
ChimeraX-RotamerLibsRichardson: 2.0
ChimeraX-SaveCommand: 1.5.1
ChimeraX-SchemeMgr: 1.0
ChimeraX-SDF: 2.0
ChimeraX-Segger: 1.0
ChimeraX-Segment: 1.0
ChimeraX-SelInspector: 1.0
ChimeraX-SeqView: 2.7.2
ChimeraX-Shape: 1.0.1
ChimeraX-Shell: 1.0.1
ChimeraX-Shortcuts: 1.1.1
ChimeraX-ShowSequences: 1.0.1
ChimeraX-SideView: 1.0.1
ChimeraX-Smiles: 2.1
ChimeraX-SmoothLines: 1.0
ChimeraX-SpaceNavigator: 1.0
ChimeraX-StdCommands: 1.10
ChimeraX-STL: 1.0
ChimeraX-Storm: 1.0
ChimeraX-StructMeasure: 1.1
ChimeraX-Struts: 1.0.1
ChimeraX-Surface: 1.0
ChimeraX-SwapAA: 2.0.1
ChimeraX-SwapRes: 2.1.3
ChimeraX-TapeMeasure: 1.0
ChimeraX-Test: 1.0
ChimeraX-Toolbar: 1.1.2
ChimeraX-ToolshedUtils: 1.2.1
ChimeraX-Tug: 1.0.1
ChimeraX-UI: 1.24.1
ChimeraX-uniprot: 2.2.1
ChimeraX-UnitCell: 1.0.1
ChimeraX-ViewDockX: 1.1.3
ChimeraX-VIPERdb: 1.0
ChimeraX-Vive: 1.1
ChimeraX-VolumeMenu: 1.0.1
ChimeraX-VTK: 1.0
ChimeraX-WavefrontOBJ: 1.0
ChimeraX-WebCam: 1.0.1
ChimeraX-WebServices: 1.1.0
ChimeraX-Zone: 1.0.1
colorama: 0.4.5
cxservices: 1.2
cycler: 0.11.0
Cython: 0.29.32
debugpy: 1.6.3
decorator: 5.1.1
docutils: 0.19
entrypoints: 0.4
executing: 1.1.0
filelock: 3.7.1
fonttools: 4.37.3
funcparserlib: 1.0.0
grako: 3.16.5
h5py: 3.7.0
html2text: 2020.1.16
idna: 3.4
ihm: 0.33
imagecodecs: 2022.7.31
imagesize: 1.4.1
importlib-metadata: 4.12.0
ipykernel: 6.15.3
ipython: 8.4.0
ipython-genutils: 0.2.0
jedi: 0.18.1
Jinja2: 3.1.2
jupyter-client: 7.3.4
jupyter-core: 4.11.1
kiwisolver: 1.4.4
line-profiler: 3.5.1
lxml: 4.9.1
lz4: 4.0.2
MarkupSafe: 2.1.1
matplotlib: 3.5.2
matplotlib-inline: 0.1.6
msgpack: 1.0.4
nest-asyncio: 1.5.5
netCDF4: 1.6.0
networkx: 2.8.5
numexpr: 2.8.3
numpy: 1.23.1
openvr: 1.23.701
packaging: 21.3
ParmEd: 3.4.3
parso: 0.8.3
pep517: 0.13.0
pexpect: 4.8.0
pickleshare: 0.7.5
Pillow: 9.2.0
pip: 22.2.2
pkginfo: 1.8.3
prompt-toolkit: 3.0.31
psutil: 5.9.1
ptyprocess: 0.7.0
pure-eval: 0.2.2
pycollada: 0.7.2
pydicom: 2.3.0
Pygments: 2.12.0
PyOpenGL: 3.1.5
PyOpenGL-accelerate: 3.1.5
pyparsing: 3.0.9
PyQt6-commercial: 6.3.1
PyQt6-Qt6: 6.3.2
PyQt6-sip: 13.4.0
PyQt6-WebEngine-commercial: 6.3.1
PyQt6-WebEngine-Qt6: 6.3.2
python-dateutil: 2.8.2
pytz: 2022.2.1
pyzmq: 24.0.1
qtconsole: 5.3.1
QtPy: 2.2.0
RandomWords: 0.4.0
requests: 2.28.1
scipy: 1.9.0
setuptools: 65.1.1
setuptools-scm: 7.0.5
sfftk-rw: 0.7.2
six: 1.16.0
snowballstemmer: 2.2.0
sortedcontainers: 2.4.0
Sphinx: 5.1.1
sphinx-autodoc-typehints: 1.19.1
sphinxcontrib-applehelp: 1.0.2
sphinxcontrib-blockdiag: 3.0.0
sphinxcontrib-devhelp: 1.0.2
sphinxcontrib-htmlhelp: 2.0.0
sphinxcontrib-jsmath: 1.0.1
sphinxcontrib-qthelp: 1.0.3
sphinxcontrib-serializinghtml: 1.1.5
stack-data: 0.5.1
tables: 3.7.0
tifffile: 2022.7.31
tinyarray: 1.2.4
tomli: 2.0.1
tornado: 6.2
traitlets: 5.3.0
typing-extensions: 4.3.0
urllib3: 1.26.12
wcwidth: 0.2.5
webcolors: 1.12
wheel: 0.37.1
wheel-filename: 1.4.1
zipp: 3.8.1
Change History (2)
comment:1 by , 4 years ago
| Cc: | added |
|---|---|
| Component: | Unassigned → UI |
| Owner: | set to |
| Platform: | → all |
| Project: | → ChimeraX |
| Status: | new → accepted |
| Summary: | ChimeraX bug report submission → KeyError in floating-tool dict after de-iconfiy |
comment:2 by , 4 years ago
Note:
See TracTickets
for help on using tickets.
Hi Dayse,
--Eric
fix: https://github.com/RBVI/ChimeraX/commit/7fc6d5376d96c4c97970a30897a53becdc5d00cc