Opened 4 years ago
Closed 4 years ago
#6477 closed defect (duplicate)
Blast error while web services down
Reported by: | Owned by: | Zach Pearson | |
---|---|---|---|
Priority: | normal | Milestone: | |
Component: | Infrastructure | Version: | |
Keywords: | Cc: | Tom Goddard | |
Blocked By: | Blocking: | ||
Notify when closed: | Platform: | all | |
Project: | ChimeraX |
Description
The following bug report has been submitted: Platform: macOS-10.16-x86_64-i386-64bit ChimeraX Version: 1.3 (2021-12-08 23:08:33 UTC) Description (Describe the actions that caused this problem to occur here) Log: UCSF ChimeraX version: 1.3 (2021-12-08) © 2016-2021 Regents of the University of California. All rights reserved. How to cite UCSF ChimeraX > ui tool show AlphaFold > alphafold match > MKEVIYRFEKAEDYKLVPVNNIYGNVTNTGEIFCDLVFESTEISEEIAYTKTKEGVLEEASKEFKSGEEGKIVLINSFIGISITKTTARNIAYWLLKKVDELEDNE No AlphaFold model with similar sequence for 1 sequences Opened 0 AlphaFold model > alphafold search > MKEVIYRFEKAEDYKLVPVNNIYGNVTNTGEIFCDLVFESTEISEEIAYTKTKEGVLEEASKEFKSGEEGKIVLINSFIGISITKTTARNIAYWLLKKVDELEDNE ChimeraX REST job id: BZ175YJ9HYY6BLAIRNHSYJ16PCDJ7W6X5OKDR9LTSP7KQ8U6TX2GD44O0EQW21TR > alphafold predict > MKEVIYRFEKAEDYKLVPVNNIYGNVTNTGEIFCDLVFESTEISEEIAYTKTKEGVLEEASKEFKSGEEGKIVLINSFIGISITKTTARNIAYWLLKKVDELEDNE Running AlphaFold prediction [Repeated 2 time(s)] Downloaded prediction file not found: /Users/andrewkrusenstjerna/Downloads/ChimeraX/AlphaFold/prediction_1/best_model.pdb AlphaFold prediction finished Results in /Users/andrewkrusenstjerna/Downloads/ChimeraX/AlphaFold/prediction_1 > alphafold predict > MKEVIYRFEKAEDYKLVPVNNIYGNVTNTGEIFCDLVFESTEISEEIAYTKTKEGVLEEASKEFKSGEEGKIVLINSFIGISITKTTARNIAYWLLKKVDELEDNE Running AlphaFold prediction Downloaded prediction file not found: /Users/andrewkrusenstjerna/Downloads/ChimeraX/AlphaFold/prediction_2/best_model.pdb AlphaFold prediction finished Results in /Users/andrewkrusenstjerna/Downloads/ChimeraX/AlphaFold/prediction_2 2022-03-28 10:03:40,246 WARNING Retrying (Retry(total=2, connect=None, read=None, redirect=None, status=None)) after connection broken by 'NewConnectionError('<urllib3.connection.HTTPConnection object at 0x7fe091a5b970>: Failed to establish a new connection: [Errno 8] nodename nor servname provided, or not known')': /cxservices/api/v1//chimerax/job/BZ175YJ9HYY6BLAIRNHSYJ16PCDJ7W6X5OKDR9LTSP7KQ8U6TX2GD44O0EQW21TR 2022-03-28 10:03:40,259 WARNING Retrying (Retry(total=1, connect=None, read=None, redirect=None, status=None)) after connection broken by 'NewConnectionError('<urllib3.connection.HTTPConnection object at 0x7fe091a9b370>: Failed to establish a new connection: [Errno 8] nodename nor servname provided, or not known')': /cxservices/api/v1//chimerax/job/BZ175YJ9HYY6BLAIRNHSYJ16PCDJ7W6X5OKDR9LTSP7KQ8U6TX2GD44O0EQW21TR 2022-03-28 10:03:40,263 WARNING Retrying (Retry(total=0, connect=None, read=None, redirect=None, status=None)) after connection broken by 'NewConnectionError('<urllib3.connection.HTTPConnection object at 0x7fe091a9b2b0>: Failed to establish a new connection: [Errno 8] nodename nor servname provided, or not known')': /cxservices/api/v1//chimerax/job/BZ175YJ9HYY6BLAIRNHSYJ16PCDJ7W6X5OKDR9LTSP7KQ8U6TX2GD44O0EQW21TR Traceback (most recent call last): File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connection.py", line 174, in _new_conn conn = connection.create_connection( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/util/connection.py", line 73, in create_connection for res in socket.getaddrinfo(host, port, family, socket.SOCK_STREAM): File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/socket.py", line 953, in getaddrinfo for res in _socket.getaddrinfo(host, port, family, type, proto, flags): socket.gaierror: [Errno 8] nodename nor servname provided, or not known During handling of the above exception, another exception occurred: Traceback (most recent call last): File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connectionpool.py", line 699, in urlopen httplib_response = self._make_request( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connectionpool.py", line 394, in _make_request conn.request(method, url, **httplib_request_kw) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connection.py", line 239, in request super(HTTPConnection, self).request(method, url, body=body, headers=headers) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/http/client.py", line 1257, in request self._send_request(method, url, body, headers, encode_chunked) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/http/client.py", line 1303, in _send_request self.endheaders(body, encode_chunked=encode_chunked) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/http/client.py", line 1252, in endheaders self._send_output(message_body, encode_chunked=encode_chunked) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/http/client.py", line 1012, in _send_output self.send(msg) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/http/client.py", line 952, in send self.connect() File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connection.py", line 205, in connect conn = self._new_conn() File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connection.py", line 186, in _new_conn raise NewConnectionError( urllib3.exceptions.NewConnectionError: <urllib3.connection.HTTPConnection object at 0x7fe091a9b1c0>: Failed to establish a new connection: [Errno 8] nodename nor servname provided, or not known During handling of the above exception, another exception occurred: Traceback (most recent call last): File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/chimerax/core/tasks.py", line 196, in _run_thread self.run(*args, **kw) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/chimerax/core/tasks.py", line 289, in run self.monitor() File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/chimerax/webservices/cxservices_job.py", line 122, in monitor status = self.api.status(self.job_id).status File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/cxservices/api/default_api.py", line 954, in status (data) = self.status_with_http_info(job_id, **kwargs) # noqa: E501 File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/cxservices/api/default_api.py", line 1013, in status_with_http_info return self.api_client.call_api( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/cxservices/api_client.py", line 316, in call_api return self.__call_api(resource_path, method, File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/cxservices/api_client.py", line 148, in __call_api response_data = self.request( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/cxservices/api_client.py", line 338, in request return self.rest_client.GET(url, File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/cxservices/rest.py", line 233, in GET return self.request("GET", url, File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/cxservices/rest.py", line 206, in request r = self.pool_manager.request(method, url, File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/request.py", line 74, in request return self.request_encode_url( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/request.py", line 96, in request_encode_url return self.urlopen(method, url, **extra_kw) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/poolmanager.py", line 375, in urlopen response = conn.urlopen(method, u.request_uri, **kw) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connectionpool.py", line 783, in urlopen return self.urlopen( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connectionpool.py", line 783, in urlopen return self.urlopen( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connectionpool.py", line 783, in urlopen return self.urlopen( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connectionpool.py", line 755, in urlopen retries = retries.increment( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/util/retry.py", line 574, in increment raise MaxRetryError(_pool, url, error or ResponseError(cause)) urllib3.exceptions.MaxRetryError: HTTPConnectionPool(host='webservices.rbvi.ucsf.edu', port=80): Max retries exceeded with url: /cxservices/api/v1//chimerax/job/BZ175YJ9HYY6BLAIRNHSYJ16PCDJ7W6X5OKDR9LTSP7KQ8U6TX2GD44O0EQW21TR (Caused by NewConnectionError('<urllib3.connection.HTTPConnection object at 0x7fe091a9b1c0>: Failed to establish a new connection: [Errno 8] nodename nor servname provided, or not known')) Exception in thread 1: urllib3.exceptions.MaxRetryError: HTTPConnectionPool(host='webservices.rbvi.ucsf.edu', port=80): Max retries exceeded with url: /cxservices/api/v1//chimerax/job/BZ175YJ9HYY6BLAIRNHSYJ16PCDJ7W6X5OKDR9LTSP7KQ8U6TX2GD44O0EQW21TR (Caused by NewConnectionError(': Failed to establish a new connection: [Errno 8] nodename nor servname provided, or not known')) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/util/retry.py", line 574, in increment raise MaxRetryError(_pool, url, error or ResponseError(cause)) See log for complete Python traceback. BlastProtein finished. 2022-03-28 10:03:41,085 WARNING Retrying (Retry(total=2, connect=None, read=None, redirect=None, status=None)) after connection broken by 'NewConnectionError('<urllib3.connection.HTTPConnection object at 0x7fe09070b640>: Failed to establish a new connection: [Errno 8] nodename nor servname provided, or not known')': /cxservices/api/v1//chimerax/files/BZ175YJ9HYY6BLAIRNHSYJ16PCDJ7W6X5OKDR9LTSP7KQ8U6TX2GD44O0EQW21TR/_stdout 2022-03-28 10:03:41,088 WARNING Retrying (Retry(total=1, connect=None, read=None, redirect=None, status=None)) after connection broken by 'NewConnectionError('<urllib3.connection.HTTPConnection object at 0x7fe0907dae50>: Failed to establish a new connection: [Errno 8] nodename nor servname provided, or not known')': /cxservices/api/v1//chimerax/files/BZ175YJ9HYY6BLAIRNHSYJ16PCDJ7W6X5OKDR9LTSP7KQ8U6TX2GD44O0EQW21TR/_stdout 2022-03-28 10:03:41,091 WARNING Retrying (Retry(total=0, connect=None, read=None, redirect=None, status=None)) after connection broken by 'NewConnectionError('<urllib3.connection.HTTPConnection object at 0x7fe0907da100>: Failed to establish a new connection: [Errno 8] nodename nor servname provided, or not known')': /cxservices/api/v1//chimerax/files/BZ175YJ9HYY6BLAIRNHSYJ16PCDJ7W6X5OKDR9LTSP7KQ8U6TX2GD44O0EQW21TR/_stdout Traceback (most recent call last): File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connection.py", line 174, in _new_conn conn = connection.create_connection( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/util/connection.py", line 73, in create_connection for res in socket.getaddrinfo(host, port, family, socket.SOCK_STREAM): File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/socket.py", line 953, in getaddrinfo for res in _socket.getaddrinfo(host, port, family, type, proto, flags): socket.gaierror: [Errno 8] nodename nor servname provided, or not known During handling of the above exception, another exception occurred: Traceback (most recent call last): File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connectionpool.py", line 699, in urlopen httplib_response = self._make_request( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connectionpool.py", line 394, in _make_request conn.request(method, url, **httplib_request_kw) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connection.py", line 239, in request super(HTTPConnection, self).request(method, url, body=body, headers=headers) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/http/client.py", line 1257, in request self._send_request(method, url, body, headers, encode_chunked) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/http/client.py", line 1303, in _send_request self.endheaders(body, encode_chunked=encode_chunked) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/http/client.py", line 1252, in endheaders self._send_output(message_body, encode_chunked=encode_chunked) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/http/client.py", line 1012, in _send_output self.send(msg) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/http/client.py", line 952, in send self.connect() File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connection.py", line 205, in connect conn = self._new_conn() File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connection.py", line 186, in _new_conn raise NewConnectionError( urllib3.exceptions.NewConnectionError: <urllib3.connection.HTTPConnection object at 0x7fe0907da580>: Failed to establish a new connection: [Errno 8] nodename nor servname provided, or not known During handling of the above exception, another exception occurred: Traceback (most recent call last): File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/chimerax/blastprotein/ui/results.py", line 466, in run self._check_job() File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/chimerax/blastprotein/ui/results.py", line 482, in _check_job out = self.job.get_stdout() File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/chimerax/webservices/cxservices_job.py", line 203, in get_stdout return self.get_file("_stdout") File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/chimerax/webservices/cxservices_job.py", line 194, in get_file content = self.api.file_get(self.job_id, filename) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/cxservices/api/default_api.py", line 54, in file_get (data) = self.file_get_with_http_info(job_id, file_name, **kwargs) # noqa: E501 File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/cxservices/api/default_api.py", line 120, in file_get_with_http_info return self.api_client.call_api( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/cxservices/api_client.py", line 316, in call_api return self.__call_api(resource_path, method, File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/cxservices/api_client.py", line 148, in __call_api response_data = self.request( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/cxservices/api_client.py", line 338, in request return self.rest_client.GET(url, File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/cxservices/rest.py", line 233, in GET return self.request("GET", url, File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/cxservices/rest.py", line 206, in request r = self.pool_manager.request(method, url, File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/request.py", line 74, in request return self.request_encode_url( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/request.py", line 96, in request_encode_url return self.urlopen(method, url, **extra_kw) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/poolmanager.py", line 375, in urlopen response = conn.urlopen(method, u.request_uri, **kw) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connectionpool.py", line 783, in urlopen return self.urlopen( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connectionpool.py", line 783, in urlopen return self.urlopen( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connectionpool.py", line 783, in urlopen return self.urlopen( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/connectionpool.py", line 755, in urlopen retries = retries.increment( File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/util/retry.py", line 574, in increment raise MaxRetryError(_pool, url, error or ResponseError(cause)) urllib3.exceptions.MaxRetryError: HTTPConnectionPool(host='webservices.rbvi.ucsf.edu', port=80): Max retries exceeded with url: /cxservices/api/v1//chimerax/files/BZ175YJ9HYY6BLAIRNHSYJ16PCDJ7W6X5OKDR9LTSP7KQ8U6TX2GD44O0EQW21TR/_stdout (Caused by NewConnectionError('<urllib3.connection.HTTPConnection object at 0x7fe0907da580>: Failed to establish a new connection: [Errno 8] nodename nor servname provided, or not known')) urllib3.exceptions.MaxRetryError: HTTPConnectionPool(host='webservices.rbvi.ucsf.edu', port=80): Max retries exceeded with url: /cxservices/api/v1//chimerax/files/BZ175YJ9HYY6BLAIRNHSYJ16PCDJ7W6X5OKDR9LTSP7KQ8U6TX2GD44O0EQW21TR/_stdout (Caused by NewConnectionError(': Failed to establish a new connection: [Errno 8] nodename nor servname provided, or not known')) File "/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site- packages/urllib3/util/retry.py", line 574, in increment raise MaxRetryError(_pool, url, error or ResponseError(cause)) See log for complete Python traceback. OpenGL version: 4.1 Metal - 76.3 OpenGL renderer: Apple M1 OpenGL vendor: AppleHardware: Hardware Overview: Model Name: MacBook Air Model Identifier: MacBookAir10,1 Processor Name: Unknown Processor Speed: 2.4 GHz Number of Processors: 1 Total Number of Cores: 8 L2 Cache: 8 MB Memory: 8 GB Software: System Software Overview: System Version: macOS 12.2.1 (21D62) Kernel Version: Darwin 21.3.0 Time since boot: 14 days 19:04 Graphics/Displays: Apple M1: Chipset Model: Apple M1 Type: GPU Bus: Built-In Total Number of Cores: 7 Vendor: Apple (0x106b) Metal Family: Supported, Metal GPUFamily Apple 7 Displays: Color LCD: Display Type: Built-In Retina LCD Resolution: 2560 x 1600 Retina Main Display: Yes Mirror: Off Online: Yes Automatically Adjust Brightness: No Connection Type: Internal Locale: (None, 'UTF-8') PyQt5 5.15.2, Qt 5.15.2 Installed Packages: alabaster: 0.7.12 appdirs: 1.4.4 appnope: 0.1.2 Babel: 2.9.1 backcall: 0.2.0 blockdiag: 2.0.1 certifi: 2021.5.30 cftime: 1.5.1.1 charset-normalizer: 2.0.9 ChimeraX-AddCharge: 1.2.2 ChimeraX-AddH: 2.1.11 ChimeraX-AlignmentAlgorithms: 2.0 ChimeraX-AlignmentHdrs: 3.2 ChimeraX-AlignmentMatrices: 2.0 ChimeraX-Alignments: 2.2.3 ChimeraX-AlphaFold: 1.0 ChimeraX-AltlocExplorer: 1.0.1 ChimeraX-AmberInfo: 1.0 ChimeraX-Arrays: 1.0 ChimeraX-Atomic: 1.31 ChimeraX-AtomicLibrary: 4.2 ChimeraX-AtomSearch: 2.0 ChimeraX-AtomSearchLibrary: 1.0 ChimeraX-AxesPlanes: 2.0 ChimeraX-BasicActions: 1.1 ChimeraX-BILD: 1.0 ChimeraX-BlastProtein: 2.0 ChimeraX-BondRot: 2.0 ChimeraX-BugReporter: 1.0 ChimeraX-BuildStructure: 2.6.1 ChimeraX-Bumps: 1.0 ChimeraX-BundleBuilder: 1.1 ChimeraX-ButtonPanel: 1.0 ChimeraX-CageBuilder: 1.0 ChimeraX-CellPack: 1.0 ChimeraX-Centroids: 1.2 ChimeraX-ChemGroup: 2.0 ChimeraX-Clashes: 2.2.2 ChimeraX-ColorActions: 1.0 ChimeraX-ColorGlobe: 1.0 ChimeraX-ColorKey: 1.5 ChimeraX-CommandLine: 1.1.5 ChimeraX-ConnectStructure: 2.0 ChimeraX-Contacts: 1.0 ChimeraX-Core: 1.3 ChimeraX-CoreFormats: 1.1 ChimeraX-coulombic: 1.3.2 ChimeraX-Crosslinks: 1.0 ChimeraX-Crystal: 1.0 ChimeraX-CrystalContacts: 1.0 ChimeraX-DataFormats: 1.2.2 ChimeraX-Dicom: 1.0 ChimeraX-DistMonitor: 1.1.5 ChimeraX-DistUI: 1.0 ChimeraX-Dssp: 2.0 ChimeraX-EMDB-SFF: 1.0 ChimeraX-ExperimentalCommands: 1.0 ChimeraX-FileHistory: 1.0 ChimeraX-FunctionKey: 1.0 ChimeraX-Geometry: 1.1 ChimeraX-gltf: 1.0 ChimeraX-Graphics: 1.1 ChimeraX-Hbonds: 2.1.2 ChimeraX-Help: 1.2 ChimeraX-HKCage: 1.3 ChimeraX-IHM: 1.1 ChimeraX-ImageFormats: 1.2 ChimeraX-IMOD: 1.0 ChimeraX-IO: 1.0.1 ChimeraX-ItemsInspection: 1.0 ChimeraX-Label: 1.1 ChimeraX-ListInfo: 1.1.1 ChimeraX-Log: 1.1.4 ChimeraX-LookingGlass: 1.1 ChimeraX-Maestro: 1.8.1 ChimeraX-Map: 1.1 ChimeraX-MapData: 2.0 ChimeraX-MapEraser: 1.0 ChimeraX-MapFilter: 2.0 ChimeraX-MapFit: 2.0 ChimeraX-MapSeries: 2.1 ChimeraX-Markers: 1.0 ChimeraX-Mask: 1.0 ChimeraX-MatchMaker: 2.0.4 ChimeraX-MDcrds: 2.6 ChimeraX-MedicalToolbar: 1.0.1 ChimeraX-Meeting: 1.0 ChimeraX-MLP: 1.1 ChimeraX-mmCIF: 2.4 ChimeraX-MMTF: 2.1 ChimeraX-Modeller: 1.2.6 ChimeraX-ModelPanel: 1.2.1 ChimeraX-ModelSeries: 1.0 ChimeraX-Mol2: 2.0 ChimeraX-Morph: 1.0 ChimeraX-MouseModes: 1.1 ChimeraX-Movie: 1.0 ChimeraX-Neuron: 1.0 ChimeraX-Nucleotides: 2.0.2 ChimeraX-OpenCommand: 1.7 ChimeraX-PDB: 2.6.5 ChimeraX-PDBBio: 1.0 ChimeraX-PDBLibrary: 1.0.2 ChimeraX-PDBMatrices: 1.0 ChimeraX-PickBlobs: 1.0 ChimeraX-Positions: 1.0 ChimeraX-PresetMgr: 1.0.1 ChimeraX-PubChem: 2.1 ChimeraX-ReadPbonds: 1.0.1 ChimeraX-Registration: 1.1 ChimeraX-RemoteControl: 1.0 ChimeraX-ResidueFit: 1.0 ChimeraX-RestServer: 1.1 ChimeraX-RNALayout: 1.0 ChimeraX-RotamerLibMgr: 2.0.1 ChimeraX-RotamerLibsDunbrack: 2.0 ChimeraX-RotamerLibsDynameomics: 2.0 ChimeraX-RotamerLibsRichardson: 2.0 ChimeraX-SaveCommand: 1.5 ChimeraX-SchemeMgr: 1.0 ChimeraX-SDF: 2.0 ChimeraX-Segger: 1.0 ChimeraX-Segment: 1.0 ChimeraX-SelInspector: 1.0 ChimeraX-SeqView: 2.4.6 ChimeraX-Shape: 1.0.1 ChimeraX-Shell: 1.0 ChimeraX-Shortcuts: 1.1 ChimeraX-ShowAttr: 1.0 ChimeraX-ShowSequences: 1.0 ChimeraX-SideView: 1.0 ChimeraX-Smiles: 2.1 ChimeraX-SmoothLines: 1.0 ChimeraX-SpaceNavigator: 1.0 ChimeraX-StdCommands: 1.6.1 ChimeraX-STL: 1.0 ChimeraX-Storm: 1.0 ChimeraX-Struts: 1.0 ChimeraX-Surface: 1.0 ChimeraX-SwapAA: 2.0 ChimeraX-SwapRes: 2.1 ChimeraX-TapeMeasure: 1.0 ChimeraX-Test: 1.0 ChimeraX-Toolbar: 1.1 ChimeraX-ToolshedUtils: 1.2 ChimeraX-Tug: 1.0 ChimeraX-UI: 1.13.7 ChimeraX-uniprot: 2.2 ChimeraX-UnitCell: 1.0 ChimeraX-ViewDockX: 1.0.1 ChimeraX-VIPERdb: 1.0 ChimeraX-Vive: 1.1 ChimeraX-VolumeMenu: 1.0 ChimeraX-VTK: 1.0 ChimeraX-WavefrontOBJ: 1.0 ChimeraX-WebCam: 1.0 ChimeraX-WebServices: 1.0 ChimeraX-Zone: 1.0 colorama: 0.4.4 cxservices: 1.1 cycler: 0.11.0 Cython: 0.29.24 decorator: 5.1.0 docutils: 0.17.1 filelock: 3.0.12 funcparserlib: 0.3.6 grako: 3.16.5 h5py: 3.6.0 html2text: 2020.1.16 idna: 3.3 ihm: 0.21 imagecodecs: 2021.4.28 imagesize: 1.3.0 ipykernel: 5.5.5 ipython: 7.23.1 ipython-genutils: 0.2.0 jedi: 0.18.0 Jinja2: 3.0.1 jupyter-client: 6.1.12 jupyter-core: 4.9.1 kiwisolver: 1.3.2 lxml: 4.6.3 lz4: 3.1.3 MarkupSafe: 2.0.1 matplotlib: 3.4.3 matplotlib-inline: 0.1.3 msgpack: 1.0.2 netCDF4: 1.5.7 networkx: 2.6.3 numexpr: 2.8.0 numpy: 1.21.2 openvr: 1.16.801 packaging: 21.0 ParmEd: 3.2.0 parso: 0.8.3 pexpect: 4.8.0 pickleshare: 0.7.5 Pillow: 8.3.2 pip: 21.2.4 pkginfo: 1.7.1 prompt-toolkit: 3.0.23 psutil: 5.8.0 ptyprocess: 0.7.0 pycollada: 0.7.1 pydicom: 2.1.2 Pygments: 2.10.0 PyOpenGL: 3.1.5 PyOpenGL-accelerate: 3.1.5 pyparsing: 3.0.6 PyQt5-commercial: 5.15.2 PyQt5-sip: 12.8.1 PyQtWebEngine-commercial: 5.15.2 python-dateutil: 2.8.2 pytz: 2021.3 pyzmq: 22.3.0 qtconsole: 5.1.1 QtPy: 1.11.3 RandomWords: 0.3.0 requests: 2.26.0 scipy: 1.7.1 setuptools: 57.5.0 sfftk-rw: 0.7.1 six: 1.16.0 snowballstemmer: 2.2.0 sortedcontainers: 2.4.0 Sphinx: 4.2.0 sphinx-autodoc-typehints: 1.12.0 sphinxcontrib-applehelp: 1.0.2 sphinxcontrib-blockdiag: 2.0.0 sphinxcontrib-devhelp: 1.0.2 sphinxcontrib-htmlhelp: 2.0.0 sphinxcontrib-jsmath: 1.0.1 sphinxcontrib-qthelp: 1.0.3 sphinxcontrib-serializinghtml: 1.1.5 suds-jurko: 0.6 tifffile: 2021.4.8 tinyarray: 1.2.3 tornado: 6.1 traitlets: 5.1.1 urllib3: 1.26.7 wcwidth: 0.2.5 webcolors: 1.11.1 wheel: 0.37.0 wheel-filename: 1.3.0
Change History (2)
comment:1 by , 4 years ago
Cc: | added |
---|---|
Component: | Unassigned → Infrastructure |
Owner: | set to |
Platform: | → all |
Project: | → ChimeraX |
Status: | new → assigned |
Summary: | ChimeraX bug report submission → Blast error while web services down |
comment:2 by , 4 years ago
Resolution: | → duplicate |
---|---|
Status: | assigned → closed |
Note:
See TracTickets
for help on using tickets.