Opened 4 years ago
Closed 4 years ago
#5691 closed defect (fixed)
Blast results problem: 'NoneType' object has no attribute 'split'
Reported by: | Owned by: | Zach Pearson | |
---|---|---|---|
Priority: | normal | Milestone: | |
Component: | Sequence | Version: | |
Keywords: | Cc: | Tom Goddard | |
Blocked By: | Blocking: | ||
Notify when closed: | Platform: | all | |
Project: | ChimeraX |
Description
The following bug report has been submitted: Platform: Linux-5.11.0-40-generic-x86_64-with-glibc2.31 ChimeraX Version: 1.3rc202111110135 (2021-11-11 01:35:07 UTC) Description Tools->Sequence Prediction->Alphafold. Pasted the sequence and then "Search" Log: UCSF ChimeraX version: 1.3rc202111110135 (2021-11-11) © 2016-2021 Regents of the University of California. All rights reserved. How to cite UCSF ChimeraX > ui tool show "Blast Protein" > open Q05FG5 fromDatabase uniprot Summary of feedback from opening Q05FG5 fetched from uniprot --- notes | Fetching Q05FG5 UniProt info from https://www.uniprot.org/uniprot/Q05FG5.xml Alignment identifier is Q05FG5 Opened UniProt Q05FG5 > open Q05FG5 format uniprot fromDatabase uniprot Summary of feedback from opening Q05FG5 fetched from uniprot --- notes | Destroying pre-existing alignment with identifier Q05FG5 Alignment identifier is Q05FG5 Opened UniProt Q05FG5 > open Q05FG5 format uniprot fromDatabase uniprot Summary of feedback from opening Q05FG5 fetched from uniprot --- notes | Destroying pre-existing alignment with identifier Q05FG5 Alignment identifier is Q05FG5 Opened UniProt Q05FG5 > ui tool show AlphaFold No sequence chosen for AlphaFold match > alphafold match > MFKILNFKDKRIRLFFKNVKVSFNYNILYIIKQMIILMYKNNGIGISSNQINCFKNIIICDVNFKKKKPLIMINPKILINNKNHTLGMEGCLSIKNFLISVLRFDKVYIKYFNIYNKKKKKIFNGIKSRCIQHEIDHLNSKLILDYSKIIFQKL No AlphaFold model with similar sequence for 1 sequences Opened 0 AlphaFold model > alphafold search > MFKILNFKDKRIRLFFKNVKVSFNYNILYIIKQMIILMYKNNGIGISSNQINCFKNIIICDVNFKKKKPLIMINPKILINNKNHTLGMEGCLSIKNFLISVLRFDKVYIKYFNIYNKKKKKIFNGIKSRCIQHEIDHLNSKLILDYSKIIFQKL ChimeraX REST job id: job_vacl565s BlastProtein finished. Traceback (most recent call last): File "/usr/lib/ucsf-chimerax/lib/python3.9/site-packages/chimerax/ui/gui.py", line 676, in customEvent func(*args, **kw) File "/usr/lib/ucsf-chimerax/lib/python3.9/site- packages/chimerax/blastprotein/job.py", line 72, in on_finish BlastProteinResults.from_job( File "/usr/lib/ucsf-chimerax/lib/python3.9/site- packages/chimerax/blastprotein/ui/results.py", line 83, in from_job return cls( File "/usr/lib/ucsf-chimerax/lib/python3.9/site- packages/chimerax/blastprotein/ui/results.py", line 79, in __init__ self._build_ui() File "/usr/lib/ucsf-chimerax/lib/python3.9/site- packages/chimerax/blastprotein/ui/results.py", line 197, in _build_ui param_str = self._format_param_str() File "/usr/lib/ucsf-chimerax/lib/python3.9/site- packages/chimerax/blastprotein/ui/results.py", line 174, in _format_param_str model_no = int(float(values[0].split('/')[0][1:])) AttributeError: 'NoneType' object has no attribute 'split' AttributeError: 'NoneType' object has no attribute 'split' File "/usr/lib/ucsf-chimerax/lib/python3.9/site- packages/chimerax/blastprotein/ui/results.py", line 174, in _format_param_str model_no = int(float(values[0].split('/')[0][1:])) See log for complete Python traceback. > alphafold search > MFKILNFKDKRIRLFFKNVKVSFNYNILYIIKQMIILMYKNNGIGISSNQINCFKNIIICDVNFKKKKPLIMINPKILINNKNHTLGMEGCLSIKNFLISVLRFDKVYIKYFNIYNKKKKKIFNGIKSRCIQHEIDHLNSKLILDYSKIIFQKL ChimeraX REST job id: job_6rsw6zvf BlastProtein finished. Traceback (most recent call last): File "/usr/lib/ucsf-chimerax/lib/python3.9/site-packages/chimerax/ui/gui.py", line 676, in customEvent func(*args, **kw) File "/usr/lib/ucsf-chimerax/lib/python3.9/site- packages/chimerax/blastprotein/job.py", line 72, in on_finish BlastProteinResults.from_job( File "/usr/lib/ucsf-chimerax/lib/python3.9/site- packages/chimerax/blastprotein/ui/results.py", line 83, in from_job return cls( File "/usr/lib/ucsf-chimerax/lib/python3.9/site- packages/chimerax/blastprotein/ui/results.py", line 79, in __init__ self._build_ui() File "/usr/lib/ucsf-chimerax/lib/python3.9/site- packages/chimerax/blastprotein/ui/results.py", line 197, in _build_ui param_str = self._format_param_str() File "/usr/lib/ucsf-chimerax/lib/python3.9/site- packages/chimerax/blastprotein/ui/results.py", line 174, in _format_param_str model_no = int(float(values[0].split('/')[0][1:])) AttributeError: 'NoneType' object has no attribute 'split' AttributeError: 'NoneType' object has no attribute 'split' File "/usr/lib/ucsf-chimerax/lib/python3.9/site- packages/chimerax/blastprotein/ui/results.py", line 174, in _format_param_str model_no = int(float(values[0].split('/')[0][1:])) See log for complete Python traceback. OpenGL version: 4.6 (Core Profile) Mesa 21.0.3 OpenGL renderer: Mesa Intel(R) HD Graphics 630 (KBL GT2) OpenGL vendor: Intel Manufacturer: Micro-Star International Co., Ltd. Model: GL62M 7RDX OS: Ubuntu 20.04 focal Architecture: 64bit ELF Virutal Machine: none CPU: 8 Intel(R) Core(TM) i7-7700HQ CPU @ 2.80GHz Cache Size: 6144 KB Memory: total used free shared buff/cache available Mem: 7.7Gi 2.6Gi 322Mi 646Mi 4.8Gi 4.1Gi Swap: 2.0Gi 1.0Mi 2.0Gi Graphics: 00:02.0 VGA compatible controller [0300]: Intel Corporation HD Graphics 630 [8086:591b] (rev 04) DeviceName: Onboard IGD Subsystem: Micro-Star International Co., Ltd. [MSI] HD Graphics 630 [1462:11c8] Locale: ('en_IN', 'ISO8859-1') PyQt5 5.15.2, Qt 5.15.2 Installed Packages: alabaster: 0.7.12 appdirs: 1.4.4 Babel: 2.9.1 backcall: 0.2.0 blockdiag: 2.0.1 certifi: 2021.10.8 cftime: 1.5.1.1 charset-normalizer: 2.0.7 ChimeraX-AddCharge: 1.1.5 ChimeraX-AddH: 2.1.10 ChimeraX-AlignmentAlgorithms: 2.0 ChimeraX-AlignmentHdrs: 3.2 ChimeraX-AlignmentMatrices: 2.0 ChimeraX-Alignments: 2.2.3 ChimeraX-AlphaFold: 1.0 ChimeraX-AltlocExplorer: 1.0.1 ChimeraX-AmberInfo: 1.0 ChimeraX-Arrays: 1.0 ChimeraX-Atomic: 1.30.2 ChimeraX-AtomicLibrary: 4.1.5 ChimeraX-AtomSearch: 2.0 ChimeraX-AtomSearchLibrary: 1.0 ChimeraX-AxesPlanes: 2.0 ChimeraX-BasicActions: 1.1 ChimeraX-BILD: 1.0 ChimeraX-BlastProtein: 2.0 ChimeraX-BondRot: 2.0 ChimeraX-BugReporter: 1.0 ChimeraX-BuildStructure: 2.6 ChimeraX-Bumps: 1.0 ChimeraX-BundleBuilder: 1.1 ChimeraX-ButtonPanel: 1.0 ChimeraX-CageBuilder: 1.0 ChimeraX-CellPack: 1.0 ChimeraX-Centroids: 1.2 ChimeraX-ChemGroup: 2.0 ChimeraX-Clashes: 2.2.2 ChimeraX-ColorActions: 1.0 ChimeraX-ColorGlobe: 1.0 ChimeraX-ColorKey: 1.5 ChimeraX-CommandLine: 1.1.5 ChimeraX-ConnectStructure: 2.0 ChimeraX-Contacts: 1.0 ChimeraX-Core: 1.3rc202111110135 ChimeraX-CoreFormats: 1.1 ChimeraX-coulombic: 1.3.1 ChimeraX-Crosslinks: 1.0 ChimeraX-Crystal: 1.0 ChimeraX-CrystalContacts: 1.0 ChimeraX-DataFormats: 1.2.2 ChimeraX-Dicom: 1.0 ChimeraX-DistMonitor: 1.1.5 ChimeraX-DistUI: 1.0 ChimeraX-Dssp: 2.0 ChimeraX-EMDB-SFF: 1.0 ChimeraX-ExperimentalCommands: 1.0 ChimeraX-FileHistory: 1.0 ChimeraX-FunctionKey: 1.0 ChimeraX-Geometry: 1.1 ChimeraX-gltf: 1.0 ChimeraX-Graphics: 1.1 ChimeraX-Hbonds: 2.1.2 ChimeraX-Help: 1.2 ChimeraX-HKCage: 1.3 ChimeraX-IHM: 1.1 ChimeraX-ImageFormats: 1.2 ChimeraX-IMOD: 1.0 ChimeraX-IO: 1.0.1 ChimeraX-ItemsInspection: 1.0 ChimeraX-Label: 1.1 ChimeraX-LinuxSupport: 1.0 ChimeraX-ListInfo: 1.1.1 ChimeraX-Log: 1.1.4 ChimeraX-LookingGlass: 1.1 ChimeraX-Maestro: 1.8.1 ChimeraX-Map: 1.1 ChimeraX-MapData: 2.0 ChimeraX-MapEraser: 1.0 ChimeraX-MapFilter: 2.0 ChimeraX-MapFit: 2.0 ChimeraX-MapSeries: 2.1 ChimeraX-Markers: 1.0 ChimeraX-Mask: 1.0 ChimeraX-MatchMaker: 2.0.4 ChimeraX-MDcrds: 2.6 ChimeraX-MedicalToolbar: 1.0.1 ChimeraX-Meeting: 1.0 ChimeraX-MLP: 1.1 ChimeraX-mmCIF: 2.4 ChimeraX-MMTF: 2.1 ChimeraX-Modeller: 1.2.6 ChimeraX-ModelPanel: 1.2.1 ChimeraX-ModelSeries: 1.0 ChimeraX-Mol2: 2.0 ChimeraX-Morph: 1.0 ChimeraX-MouseModes: 1.1 ChimeraX-Movie: 1.0 ChimeraX-Neuron: 1.0 ChimeraX-Nucleotides: 2.0.2 ChimeraX-OpenCommand: 1.7 ChimeraX-PDB: 2.6.5 ChimeraX-PDBBio: 1.0 ChimeraX-PDBLibrary: 1.0.2 ChimeraX-PDBMatrices: 1.0 ChimeraX-PickBlobs: 1.0 ChimeraX-Positions: 1.0 ChimeraX-PresetMgr: 1.0.1 ChimeraX-PubChem: 2.1 ChimeraX-ReadPbonds: 1.0 ChimeraX-Registration: 1.1 ChimeraX-RemoteControl: 1.0 ChimeraX-ResidueFit: 1.0 ChimeraX-RestServer: 1.1 ChimeraX-RNALayout: 1.0 ChimeraX-RotamerLibMgr: 2.0.1 ChimeraX-RotamerLibsDunbrack: 2.0 ChimeraX-RotamerLibsDynameomics: 2.0 ChimeraX-RotamerLibsRichardson: 2.0 ChimeraX-SaveCommand: 1.5 ChimeraX-SchemeMgr: 1.0 ChimeraX-SDF: 2.0 ChimeraX-Segger: 1.0 ChimeraX-Segment: 1.0 ChimeraX-SelInspector: 1.0 ChimeraX-SeqView: 2.4.6 ChimeraX-Shape: 1.0.1 ChimeraX-Shell: 1.0 ChimeraX-Shortcuts: 1.1 ChimeraX-ShowAttr: 1.0 ChimeraX-ShowSequences: 1.0 ChimeraX-SideView: 1.0 ChimeraX-Smiles: 2.1 ChimeraX-SmoothLines: 1.0 ChimeraX-SpaceNavigator: 1.0 ChimeraX-StdCommands: 1.6 ChimeraX-STL: 1.0 ChimeraX-Storm: 1.0 ChimeraX-Struts: 1.0 ChimeraX-Surface: 1.0 ChimeraX-SwapAA: 2.0 ChimeraX-SwapRes: 2.1 ChimeraX-TapeMeasure: 1.0 ChimeraX-Test: 1.0 ChimeraX-Toolbar: 1.1 ChimeraX-ToolshedUtils: 1.2 ChimeraX-Tug: 1.0 ChimeraX-UI: 1.13.7 ChimeraX-uniprot: 2.2 ChimeraX-UnitCell: 1.0 ChimeraX-ViewDockX: 1.0.1 ChimeraX-VIPERdb: 1.0 ChimeraX-Vive: 1.1 ChimeraX-VolumeMenu: 1.0 ChimeraX-VTK: 1.0 ChimeraX-WavefrontOBJ: 1.0 ChimeraX-WebCam: 1.0 ChimeraX-WebServices: 1.0 ChimeraX-Zone: 1.0 colorama: 0.4.4 cxservices: 1.1 cycler: 0.11.0 Cython: 0.29.24 decorator: 5.1.0 distro: 1.6.0 docutils: 0.17.1 filelock: 3.0.12 funcparserlib: 0.3.6 grako: 3.16.5 h5py: 3.5.0 html2text: 2020.1.16 idna: 3.3 ihm: 0.21 imagecodecs: 2021.4.28 imagesize: 1.3.0 ipykernel: 5.5.5 ipython: 7.23.1 ipython-genutils: 0.2.0 jedi: 0.18.0 Jinja2: 3.0.1 jupyter-client: 6.1.12 jupyter-core: 4.9.1 kiwisolver: 1.3.2 line-profiler: 3.3.0 lxml: 4.6.3 lz4: 3.1.3 MarkupSafe: 2.0.1 matplotlib: 3.4.3 matplotlib-inline: 0.1.3 msgpack: 1.0.2 netCDF4: 1.5.7 networkx: 2.6.3 numexpr: 2.7.3 numpy: 1.21.2 openvr: 1.16.801 packaging: 21.2 ParmEd: 3.2.0 parso: 0.8.2 pexpect: 4.8.0 pickleshare: 0.7.5 Pillow: 8.3.2 pip: 21.2.4 pkginfo: 1.7.1 prompt-toolkit: 3.0.22 psutil: 5.8.0 ptyprocess: 0.7.0 pycollada: 0.7.1 pydicom: 2.1.2 Pygments: 2.10.0 PyOpenGL: 3.1.5 PyOpenGL-accelerate: 3.1.5 pyparsing: 2.4.7 PyQt5-commercial: 5.15.2 PyQt5-sip: 12.8.1 PyQtWebEngine-commercial: 5.15.2 python-dateutil: 2.8.2 pytz: 2021.3 pyzmq: 22.3.0 qtconsole: 5.1.1 QtPy: 1.11.2 RandomWords: 0.3.0 requests: 2.26.0 scipy: 1.7.1 setuptools: 57.5.0 sfftk-rw: 0.7.1 six: 1.16.0 snowballstemmer: 2.1.0 sortedcontainers: 2.4.0 Sphinx: 4.2.0 sphinx-autodoc-typehints: 1.12.0 sphinxcontrib-applehelp: 1.0.2 sphinxcontrib-blockdiag: 2.0.0 sphinxcontrib-devhelp: 1.0.2 sphinxcontrib-htmlhelp: 2.0.0 sphinxcontrib-jsmath: 1.0.1 sphinxcontrib-qthelp: 1.0.3 sphinxcontrib-serializinghtml: 1.1.5 suds-jurko: 0.6 tables: 3.6.1 tifffile: 2021.4.8 tinyarray: 1.2.3 tornado: 6.1 traitlets: 5.1.1 urllib3: 1.26.7 wcwidth: 0.2.5 webcolors: 1.11.1 wheel: 0.37.0 wheel-filename: 1.3.0
Change History (2)
comment:1 by , 4 years ago
Cc: | added |
---|---|
Component: | Unassigned → Sequence |
Owner: | set to |
Platform: | → all |
Project: | → ChimeraX |
Status: | new → assigned |
Summary: | ChimeraX bug report submission → Blast results problem: 'NoneType' object has no attribute 'split' |
comment:2 by , 4 years ago
Resolution: | → fixed |
---|---|
Status: | assigned → closed |
Note:
See TracTickets
for help on using tickets.
Duplicate of #5579
Thank you for this bug report. I believe the issue was fixed in a recent
daily build, so updating to the latest daily build should resolve the
issue. If it doesn't, please don't hesitate to reopen this ticket, or file
another bug report.