Opened 4 years ago

Closed 4 years ago

#5691 closed defect (fixed)

Blast results problem: 'NoneType' object has no attribute 'split'

Reported by: manav.sivaram@… Owned by: Zach Pearson
Priority: normal Milestone:
Component: Sequence Version:
Keywords: Cc: Tom Goddard
Blocked By: Blocking:
Notify when closed: Platform: all
Project: ChimeraX

Description

The following bug report has been submitted:
Platform:        Linux-5.11.0-40-generic-x86_64-with-glibc2.31
ChimeraX Version: 1.3rc202111110135 (2021-11-11 01:35:07 UTC)
Description
Tools->Sequence Prediction->Alphafold. Pasted the sequence and then "Search"

Log:
UCSF ChimeraX version: 1.3rc202111110135 (2021-11-11)  
© 2016-2021 Regents of the University of California. All rights reserved.  
How to cite UCSF ChimeraX  

> ui tool show "Blast Protein"

> open Q05FG5 fromDatabase uniprot

Summary of feedback from opening Q05FG5 fetched from uniprot  
---  
notes | Fetching Q05FG5 UniProt info from
https://www.uniprot.org/uniprot/Q05FG5.xml  
Alignment identifier is Q05FG5  
  
Opened UniProt Q05FG5  

> open Q05FG5 format uniprot fromDatabase uniprot

Summary of feedback from opening Q05FG5 fetched from uniprot  
---  
notes | Destroying pre-existing alignment with identifier Q05FG5  
Alignment identifier is Q05FG5  
  
Opened UniProt Q05FG5  

> open Q05FG5 format uniprot fromDatabase uniprot

Summary of feedback from opening Q05FG5 fetched from uniprot  
---  
notes | Destroying pre-existing alignment with identifier Q05FG5  
Alignment identifier is Q05FG5  
  
Opened UniProt Q05FG5  

> ui tool show AlphaFold

No sequence chosen for AlphaFold match  

> alphafold match
> MFKILNFKDKRIRLFFKNVKVSFNYNILYIIKQMIILMYKNNGIGISSNQINCFKNIIICDVNFKKKKPLIMINPKILINNKNHTLGMEGCLSIKNFLISVLRFDKVYIKYFNIYNKKKKKIFNGIKSRCIQHEIDHLNSKLILDYSKIIFQKL

No AlphaFold model with similar sequence for 1 sequences  

Opened 0 AlphaFold model  

> alphafold search
> MFKILNFKDKRIRLFFKNVKVSFNYNILYIIKQMIILMYKNNGIGISSNQINCFKNIIICDVNFKKKKPLIMINPKILINNKNHTLGMEGCLSIKNFLISVLRFDKVYIKYFNIYNKKKKKIFNGIKSRCIQHEIDHLNSKLILDYSKIIFQKL

ChimeraX REST job id: job_vacl565s  
BlastProtein finished.  
Traceback (most recent call last):  
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-packages/chimerax/ui/gui.py",
line 676, in customEvent  
func(*args, **kw)  
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/job.py", line 72, in on_finish  
BlastProteinResults.from_job(  
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 83, in from_job  
return cls(  
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 79, in __init__  
self._build_ui()  
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 197, in _build_ui  
param_str = self._format_param_str()  
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 174, in _format_param_str  
model_no = int(float(values[0].split('/')[0][1:]))  
AttributeError: 'NoneType' object has no attribute 'split'  
  
AttributeError: 'NoneType' object has no attribute 'split'  
  
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 174, in _format_param_str  
model_no = int(float(values[0].split('/')[0][1:]))  
  
See log for complete Python traceback.  
  

> alphafold search
> MFKILNFKDKRIRLFFKNVKVSFNYNILYIIKQMIILMYKNNGIGISSNQINCFKNIIICDVNFKKKKPLIMINPKILINNKNHTLGMEGCLSIKNFLISVLRFDKVYIKYFNIYNKKKKKIFNGIKSRCIQHEIDHLNSKLILDYSKIIFQKL

ChimeraX REST job id: job_6rsw6zvf  
BlastProtein finished.  
Traceback (most recent call last):  
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-packages/chimerax/ui/gui.py",
line 676, in customEvent  
func(*args, **kw)  
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/job.py", line 72, in on_finish  
BlastProteinResults.from_job(  
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 83, in from_job  
return cls(  
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 79, in __init__  
self._build_ui()  
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 197, in _build_ui  
param_str = self._format_param_str()  
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 174, in _format_param_str  
model_no = int(float(values[0].split('/')[0][1:]))  
AttributeError: 'NoneType' object has no attribute 'split'  
  
AttributeError: 'NoneType' object has no attribute 'split'  
  
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 174, in _format_param_str  
model_no = int(float(values[0].split('/')[0][1:]))  
  
See log for complete Python traceback.  
  




OpenGL version: 4.6 (Core Profile) Mesa 21.0.3
OpenGL renderer: Mesa Intel(R) HD Graphics 630 (KBL GT2)
OpenGL vendor: Intel
Manufacturer: Micro-Star International Co., Ltd.
Model: GL62M 7RDX
OS: Ubuntu 20.04 focal
Architecture: 64bit ELF
Virutal Machine: none
CPU: 8 Intel(R) Core(TM) i7-7700HQ CPU @ 2.80GHz
Cache Size: 6144 KB
Memory:
	              total        used        free      shared  buff/cache   available
	Mem:          7.7Gi       2.6Gi       322Mi       646Mi       4.8Gi       4.1Gi
	Swap:         2.0Gi       1.0Mi       2.0Gi

Graphics:
	00:02.0 VGA compatible controller [0300]: Intel Corporation HD Graphics 630 [8086:591b] (rev 04)	
	DeviceName:  Onboard IGD	
	Subsystem: Micro-Star International Co., Ltd. [MSI] HD Graphics 630 [1462:11c8]
Locale: ('en_IN', 'ISO8859-1')
PyQt5 5.15.2, Qt 5.15.2
Installed Packages:
    alabaster: 0.7.12
    appdirs: 1.4.4
    Babel: 2.9.1
    backcall: 0.2.0
    blockdiag: 2.0.1
    certifi: 2021.10.8
    cftime: 1.5.1.1
    charset-normalizer: 2.0.7
    ChimeraX-AddCharge: 1.1.5
    ChimeraX-AddH: 2.1.10
    ChimeraX-AlignmentAlgorithms: 2.0
    ChimeraX-AlignmentHdrs: 3.2
    ChimeraX-AlignmentMatrices: 2.0
    ChimeraX-Alignments: 2.2.3
    ChimeraX-AlphaFold: 1.0
    ChimeraX-AltlocExplorer: 1.0.1
    ChimeraX-AmberInfo: 1.0
    ChimeraX-Arrays: 1.0
    ChimeraX-Atomic: 1.30.2
    ChimeraX-AtomicLibrary: 4.1.5
    ChimeraX-AtomSearch: 2.0
    ChimeraX-AtomSearchLibrary: 1.0
    ChimeraX-AxesPlanes: 2.0
    ChimeraX-BasicActions: 1.1
    ChimeraX-BILD: 1.0
    ChimeraX-BlastProtein: 2.0
    ChimeraX-BondRot: 2.0
    ChimeraX-BugReporter: 1.0
    ChimeraX-BuildStructure: 2.6
    ChimeraX-Bumps: 1.0
    ChimeraX-BundleBuilder: 1.1
    ChimeraX-ButtonPanel: 1.0
    ChimeraX-CageBuilder: 1.0
    ChimeraX-CellPack: 1.0
    ChimeraX-Centroids: 1.2
    ChimeraX-ChemGroup: 2.0
    ChimeraX-Clashes: 2.2.2
    ChimeraX-ColorActions: 1.0
    ChimeraX-ColorGlobe: 1.0
    ChimeraX-ColorKey: 1.5
    ChimeraX-CommandLine: 1.1.5
    ChimeraX-ConnectStructure: 2.0
    ChimeraX-Contacts: 1.0
    ChimeraX-Core: 1.3rc202111110135
    ChimeraX-CoreFormats: 1.1
    ChimeraX-coulombic: 1.3.1
    ChimeraX-Crosslinks: 1.0
    ChimeraX-Crystal: 1.0
    ChimeraX-CrystalContacts: 1.0
    ChimeraX-DataFormats: 1.2.2
    ChimeraX-Dicom: 1.0
    ChimeraX-DistMonitor: 1.1.5
    ChimeraX-DistUI: 1.0
    ChimeraX-Dssp: 2.0
    ChimeraX-EMDB-SFF: 1.0
    ChimeraX-ExperimentalCommands: 1.0
    ChimeraX-FileHistory: 1.0
    ChimeraX-FunctionKey: 1.0
    ChimeraX-Geometry: 1.1
    ChimeraX-gltf: 1.0
    ChimeraX-Graphics: 1.1
    ChimeraX-Hbonds: 2.1.2
    ChimeraX-Help: 1.2
    ChimeraX-HKCage: 1.3
    ChimeraX-IHM: 1.1
    ChimeraX-ImageFormats: 1.2
    ChimeraX-IMOD: 1.0
    ChimeraX-IO: 1.0.1
    ChimeraX-ItemsInspection: 1.0
    ChimeraX-Label: 1.1
    ChimeraX-LinuxSupport: 1.0
    ChimeraX-ListInfo: 1.1.1
    ChimeraX-Log: 1.1.4
    ChimeraX-LookingGlass: 1.1
    ChimeraX-Maestro: 1.8.1
    ChimeraX-Map: 1.1
    ChimeraX-MapData: 2.0
    ChimeraX-MapEraser: 1.0
    ChimeraX-MapFilter: 2.0
    ChimeraX-MapFit: 2.0
    ChimeraX-MapSeries: 2.1
    ChimeraX-Markers: 1.0
    ChimeraX-Mask: 1.0
    ChimeraX-MatchMaker: 2.0.4
    ChimeraX-MDcrds: 2.6
    ChimeraX-MedicalToolbar: 1.0.1
    ChimeraX-Meeting: 1.0
    ChimeraX-MLP: 1.1
    ChimeraX-mmCIF: 2.4
    ChimeraX-MMTF: 2.1
    ChimeraX-Modeller: 1.2.6
    ChimeraX-ModelPanel: 1.2.1
    ChimeraX-ModelSeries: 1.0
    ChimeraX-Mol2: 2.0
    ChimeraX-Morph: 1.0
    ChimeraX-MouseModes: 1.1
    ChimeraX-Movie: 1.0
    ChimeraX-Neuron: 1.0
    ChimeraX-Nucleotides: 2.0.2
    ChimeraX-OpenCommand: 1.7
    ChimeraX-PDB: 2.6.5
    ChimeraX-PDBBio: 1.0
    ChimeraX-PDBLibrary: 1.0.2
    ChimeraX-PDBMatrices: 1.0
    ChimeraX-PickBlobs: 1.0
    ChimeraX-Positions: 1.0
    ChimeraX-PresetMgr: 1.0.1
    ChimeraX-PubChem: 2.1
    ChimeraX-ReadPbonds: 1.0
    ChimeraX-Registration: 1.1
    ChimeraX-RemoteControl: 1.0
    ChimeraX-ResidueFit: 1.0
    ChimeraX-RestServer: 1.1
    ChimeraX-RNALayout: 1.0
    ChimeraX-RotamerLibMgr: 2.0.1
    ChimeraX-RotamerLibsDunbrack: 2.0
    ChimeraX-RotamerLibsDynameomics: 2.0
    ChimeraX-RotamerLibsRichardson: 2.0
    ChimeraX-SaveCommand: 1.5
    ChimeraX-SchemeMgr: 1.0
    ChimeraX-SDF: 2.0
    ChimeraX-Segger: 1.0
    ChimeraX-Segment: 1.0
    ChimeraX-SelInspector: 1.0
    ChimeraX-SeqView: 2.4.6
    ChimeraX-Shape: 1.0.1
    ChimeraX-Shell: 1.0
    ChimeraX-Shortcuts: 1.1
    ChimeraX-ShowAttr: 1.0
    ChimeraX-ShowSequences: 1.0
    ChimeraX-SideView: 1.0
    ChimeraX-Smiles: 2.1
    ChimeraX-SmoothLines: 1.0
    ChimeraX-SpaceNavigator: 1.0
    ChimeraX-StdCommands: 1.6
    ChimeraX-STL: 1.0
    ChimeraX-Storm: 1.0
    ChimeraX-Struts: 1.0
    ChimeraX-Surface: 1.0
    ChimeraX-SwapAA: 2.0
    ChimeraX-SwapRes: 2.1
    ChimeraX-TapeMeasure: 1.0
    ChimeraX-Test: 1.0
    ChimeraX-Toolbar: 1.1
    ChimeraX-ToolshedUtils: 1.2
    ChimeraX-Tug: 1.0
    ChimeraX-UI: 1.13.7
    ChimeraX-uniprot: 2.2
    ChimeraX-UnitCell: 1.0
    ChimeraX-ViewDockX: 1.0.1
    ChimeraX-VIPERdb: 1.0
    ChimeraX-Vive: 1.1
    ChimeraX-VolumeMenu: 1.0
    ChimeraX-VTK: 1.0
    ChimeraX-WavefrontOBJ: 1.0
    ChimeraX-WebCam: 1.0
    ChimeraX-WebServices: 1.0
    ChimeraX-Zone: 1.0
    colorama: 0.4.4
    cxservices: 1.1
    cycler: 0.11.0
    Cython: 0.29.24
    decorator: 5.1.0
    distro: 1.6.0
    docutils: 0.17.1
    filelock: 3.0.12
    funcparserlib: 0.3.6
    grako: 3.16.5
    h5py: 3.5.0
    html2text: 2020.1.16
    idna: 3.3
    ihm: 0.21
    imagecodecs: 2021.4.28
    imagesize: 1.3.0
    ipykernel: 5.5.5
    ipython: 7.23.1
    ipython-genutils: 0.2.0
    jedi: 0.18.0
    Jinja2: 3.0.1
    jupyter-client: 6.1.12
    jupyter-core: 4.9.1
    kiwisolver: 1.3.2
    line-profiler: 3.3.0
    lxml: 4.6.3
    lz4: 3.1.3
    MarkupSafe: 2.0.1
    matplotlib: 3.4.3
    matplotlib-inline: 0.1.3
    msgpack: 1.0.2
    netCDF4: 1.5.7
    networkx: 2.6.3
    numexpr: 2.7.3
    numpy: 1.21.2
    openvr: 1.16.801
    packaging: 21.2
    ParmEd: 3.2.0
    parso: 0.8.2
    pexpect: 4.8.0
    pickleshare: 0.7.5
    Pillow: 8.3.2
    pip: 21.2.4
    pkginfo: 1.7.1
    prompt-toolkit: 3.0.22
    psutil: 5.8.0
    ptyprocess: 0.7.0
    pycollada: 0.7.1
    pydicom: 2.1.2
    Pygments: 2.10.0
    PyOpenGL: 3.1.5
    PyOpenGL-accelerate: 3.1.5
    pyparsing: 2.4.7
    PyQt5-commercial: 5.15.2
    PyQt5-sip: 12.8.1
    PyQtWebEngine-commercial: 5.15.2
    python-dateutil: 2.8.2
    pytz: 2021.3
    pyzmq: 22.3.0
    qtconsole: 5.1.1
    QtPy: 1.11.2
    RandomWords: 0.3.0
    requests: 2.26.0
    scipy: 1.7.1
    setuptools: 57.5.0
    sfftk-rw: 0.7.1
    six: 1.16.0
    snowballstemmer: 2.1.0
    sortedcontainers: 2.4.0
    Sphinx: 4.2.0
    sphinx-autodoc-typehints: 1.12.0
    sphinxcontrib-applehelp: 1.0.2
    sphinxcontrib-blockdiag: 2.0.0
    sphinxcontrib-devhelp: 1.0.2
    sphinxcontrib-htmlhelp: 2.0.0
    sphinxcontrib-jsmath: 1.0.1
    sphinxcontrib-qthelp: 1.0.3
    sphinxcontrib-serializinghtml: 1.1.5
    suds-jurko: 0.6
    tables: 3.6.1
    tifffile: 2021.4.8
    tinyarray: 1.2.3
    tornado: 6.1
    traitlets: 5.1.1
    urllib3: 1.26.7
    wcwidth: 0.2.5
    webcolors: 1.11.1
    wheel: 0.37.0
    wheel-filename: 1.3.0

Change History (2)

comment:1 by Eric Pettersen, 4 years ago

Cc: Tom Goddard added
Component: UnassignedSequence
Owner: set to Zach Pearson
Platform: all
Project: ChimeraX
Status: newassigned
Summary: ChimeraX bug report submissionBlast results problem: 'NoneType' object has no attribute 'split'

comment:2 by Zach Pearson, 4 years ago

Resolution: fixed
Status: assignedclosed

Duplicate of #5579

Thank you for this bug report. I believe the issue was fixed in a recent
daily build, so updating to the latest daily build should resolve the
issue. If it doesn't, please don't hesitate to reopen this ticket, or file
another bug report.

Note: See TracTickets for help on using tickets.