Opened 4 years ago
Closed 4 years ago
#5691 closed defect (fixed)
Blast results problem: 'NoneType' object has no attribute 'split'
| Reported by: | Owned by: | Zach Pearson | |
|---|---|---|---|
| Priority: | normal | Milestone: | |
| Component: | Sequence | Version: | |
| Keywords: | Cc: | Tom Goddard | |
| Blocked By: | Blocking: | ||
| Notify when closed: | Platform: | all | |
| Project: | ChimeraX |
Description
The following bug report has been submitted:
Platform: Linux-5.11.0-40-generic-x86_64-with-glibc2.31
ChimeraX Version: 1.3rc202111110135 (2021-11-11 01:35:07 UTC)
Description
Tools->Sequence Prediction->Alphafold. Pasted the sequence and then "Search"
Log:
UCSF ChimeraX version: 1.3rc202111110135 (2021-11-11)
© 2016-2021 Regents of the University of California. All rights reserved.
How to cite UCSF ChimeraX
> ui tool show "Blast Protein"
> open Q05FG5 fromDatabase uniprot
Summary of feedback from opening Q05FG5 fetched from uniprot
---
notes | Fetching Q05FG5 UniProt info from
https://www.uniprot.org/uniprot/Q05FG5.xml
Alignment identifier is Q05FG5
Opened UniProt Q05FG5
> open Q05FG5 format uniprot fromDatabase uniprot
Summary of feedback from opening Q05FG5 fetched from uniprot
---
notes | Destroying pre-existing alignment with identifier Q05FG5
Alignment identifier is Q05FG5
Opened UniProt Q05FG5
> open Q05FG5 format uniprot fromDatabase uniprot
Summary of feedback from opening Q05FG5 fetched from uniprot
---
notes | Destroying pre-existing alignment with identifier Q05FG5
Alignment identifier is Q05FG5
Opened UniProt Q05FG5
> ui tool show AlphaFold
No sequence chosen for AlphaFold match
> alphafold match
> MFKILNFKDKRIRLFFKNVKVSFNYNILYIIKQMIILMYKNNGIGISSNQINCFKNIIICDVNFKKKKPLIMINPKILINNKNHTLGMEGCLSIKNFLISVLRFDKVYIKYFNIYNKKKKKIFNGIKSRCIQHEIDHLNSKLILDYSKIIFQKL
No AlphaFold model with similar sequence for 1 sequences
Opened 0 AlphaFold model
> alphafold search
> MFKILNFKDKRIRLFFKNVKVSFNYNILYIIKQMIILMYKNNGIGISSNQINCFKNIIICDVNFKKKKPLIMINPKILINNKNHTLGMEGCLSIKNFLISVLRFDKVYIKYFNIYNKKKKKIFNGIKSRCIQHEIDHLNSKLILDYSKIIFQKL
ChimeraX REST job id: job_vacl565s
BlastProtein finished.
Traceback (most recent call last):
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-packages/chimerax/ui/gui.py",
line 676, in customEvent
func(*args, **kw)
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/job.py", line 72, in on_finish
BlastProteinResults.from_job(
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 83, in from_job
return cls(
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 79, in __init__
self._build_ui()
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 197, in _build_ui
param_str = self._format_param_str()
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 174, in _format_param_str
model_no = int(float(values[0].split('/')[0][1:]))
AttributeError: 'NoneType' object has no attribute 'split'
AttributeError: 'NoneType' object has no attribute 'split'
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 174, in _format_param_str
model_no = int(float(values[0].split('/')[0][1:]))
See log for complete Python traceback.
> alphafold search
> MFKILNFKDKRIRLFFKNVKVSFNYNILYIIKQMIILMYKNNGIGISSNQINCFKNIIICDVNFKKKKPLIMINPKILINNKNHTLGMEGCLSIKNFLISVLRFDKVYIKYFNIYNKKKKKIFNGIKSRCIQHEIDHLNSKLILDYSKIIFQKL
ChimeraX REST job id: job_6rsw6zvf
BlastProtein finished.
Traceback (most recent call last):
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-packages/chimerax/ui/gui.py",
line 676, in customEvent
func(*args, **kw)
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/job.py", line 72, in on_finish
BlastProteinResults.from_job(
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 83, in from_job
return cls(
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 79, in __init__
self._build_ui()
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 197, in _build_ui
param_str = self._format_param_str()
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 174, in _format_param_str
model_no = int(float(values[0].split('/')[0][1:]))
AttributeError: 'NoneType' object has no attribute 'split'
AttributeError: 'NoneType' object has no attribute 'split'
File "/usr/lib/ucsf-chimerax/lib/python3.9/site-
packages/chimerax/blastprotein/ui/results.py", line 174, in _format_param_str
model_no = int(float(values[0].split('/')[0][1:]))
See log for complete Python traceback.
OpenGL version: 4.6 (Core Profile) Mesa 21.0.3
OpenGL renderer: Mesa Intel(R) HD Graphics 630 (KBL GT2)
OpenGL vendor: Intel
Manufacturer: Micro-Star International Co., Ltd.
Model: GL62M 7RDX
OS: Ubuntu 20.04 focal
Architecture: 64bit ELF
Virutal Machine: none
CPU: 8 Intel(R) Core(TM) i7-7700HQ CPU @ 2.80GHz
Cache Size: 6144 KB
Memory:
total used free shared buff/cache available
Mem: 7.7Gi 2.6Gi 322Mi 646Mi 4.8Gi 4.1Gi
Swap: 2.0Gi 1.0Mi 2.0Gi
Graphics:
00:02.0 VGA compatible controller [0300]: Intel Corporation HD Graphics 630 [8086:591b] (rev 04)
DeviceName: Onboard IGD
Subsystem: Micro-Star International Co., Ltd. [MSI] HD Graphics 630 [1462:11c8]
Locale: ('en_IN', 'ISO8859-1')
PyQt5 5.15.2, Qt 5.15.2
Installed Packages:
alabaster: 0.7.12
appdirs: 1.4.4
Babel: 2.9.1
backcall: 0.2.0
blockdiag: 2.0.1
certifi: 2021.10.8
cftime: 1.5.1.1
charset-normalizer: 2.0.7
ChimeraX-AddCharge: 1.1.5
ChimeraX-AddH: 2.1.10
ChimeraX-AlignmentAlgorithms: 2.0
ChimeraX-AlignmentHdrs: 3.2
ChimeraX-AlignmentMatrices: 2.0
ChimeraX-Alignments: 2.2.3
ChimeraX-AlphaFold: 1.0
ChimeraX-AltlocExplorer: 1.0.1
ChimeraX-AmberInfo: 1.0
ChimeraX-Arrays: 1.0
ChimeraX-Atomic: 1.30.2
ChimeraX-AtomicLibrary: 4.1.5
ChimeraX-AtomSearch: 2.0
ChimeraX-AtomSearchLibrary: 1.0
ChimeraX-AxesPlanes: 2.0
ChimeraX-BasicActions: 1.1
ChimeraX-BILD: 1.0
ChimeraX-BlastProtein: 2.0
ChimeraX-BondRot: 2.0
ChimeraX-BugReporter: 1.0
ChimeraX-BuildStructure: 2.6
ChimeraX-Bumps: 1.0
ChimeraX-BundleBuilder: 1.1
ChimeraX-ButtonPanel: 1.0
ChimeraX-CageBuilder: 1.0
ChimeraX-CellPack: 1.0
ChimeraX-Centroids: 1.2
ChimeraX-ChemGroup: 2.0
ChimeraX-Clashes: 2.2.2
ChimeraX-ColorActions: 1.0
ChimeraX-ColorGlobe: 1.0
ChimeraX-ColorKey: 1.5
ChimeraX-CommandLine: 1.1.5
ChimeraX-ConnectStructure: 2.0
ChimeraX-Contacts: 1.0
ChimeraX-Core: 1.3rc202111110135
ChimeraX-CoreFormats: 1.1
ChimeraX-coulombic: 1.3.1
ChimeraX-Crosslinks: 1.0
ChimeraX-Crystal: 1.0
ChimeraX-CrystalContacts: 1.0
ChimeraX-DataFormats: 1.2.2
ChimeraX-Dicom: 1.0
ChimeraX-DistMonitor: 1.1.5
ChimeraX-DistUI: 1.0
ChimeraX-Dssp: 2.0
ChimeraX-EMDB-SFF: 1.0
ChimeraX-ExperimentalCommands: 1.0
ChimeraX-FileHistory: 1.0
ChimeraX-FunctionKey: 1.0
ChimeraX-Geometry: 1.1
ChimeraX-gltf: 1.0
ChimeraX-Graphics: 1.1
ChimeraX-Hbonds: 2.1.2
ChimeraX-Help: 1.2
ChimeraX-HKCage: 1.3
ChimeraX-IHM: 1.1
ChimeraX-ImageFormats: 1.2
ChimeraX-IMOD: 1.0
ChimeraX-IO: 1.0.1
ChimeraX-ItemsInspection: 1.0
ChimeraX-Label: 1.1
ChimeraX-LinuxSupport: 1.0
ChimeraX-ListInfo: 1.1.1
ChimeraX-Log: 1.1.4
ChimeraX-LookingGlass: 1.1
ChimeraX-Maestro: 1.8.1
ChimeraX-Map: 1.1
ChimeraX-MapData: 2.0
ChimeraX-MapEraser: 1.0
ChimeraX-MapFilter: 2.0
ChimeraX-MapFit: 2.0
ChimeraX-MapSeries: 2.1
ChimeraX-Markers: 1.0
ChimeraX-Mask: 1.0
ChimeraX-MatchMaker: 2.0.4
ChimeraX-MDcrds: 2.6
ChimeraX-MedicalToolbar: 1.0.1
ChimeraX-Meeting: 1.0
ChimeraX-MLP: 1.1
ChimeraX-mmCIF: 2.4
ChimeraX-MMTF: 2.1
ChimeraX-Modeller: 1.2.6
ChimeraX-ModelPanel: 1.2.1
ChimeraX-ModelSeries: 1.0
ChimeraX-Mol2: 2.0
ChimeraX-Morph: 1.0
ChimeraX-MouseModes: 1.1
ChimeraX-Movie: 1.0
ChimeraX-Neuron: 1.0
ChimeraX-Nucleotides: 2.0.2
ChimeraX-OpenCommand: 1.7
ChimeraX-PDB: 2.6.5
ChimeraX-PDBBio: 1.0
ChimeraX-PDBLibrary: 1.0.2
ChimeraX-PDBMatrices: 1.0
ChimeraX-PickBlobs: 1.0
ChimeraX-Positions: 1.0
ChimeraX-PresetMgr: 1.0.1
ChimeraX-PubChem: 2.1
ChimeraX-ReadPbonds: 1.0
ChimeraX-Registration: 1.1
ChimeraX-RemoteControl: 1.0
ChimeraX-ResidueFit: 1.0
ChimeraX-RestServer: 1.1
ChimeraX-RNALayout: 1.0
ChimeraX-RotamerLibMgr: 2.0.1
ChimeraX-RotamerLibsDunbrack: 2.0
ChimeraX-RotamerLibsDynameomics: 2.0
ChimeraX-RotamerLibsRichardson: 2.0
ChimeraX-SaveCommand: 1.5
ChimeraX-SchemeMgr: 1.0
ChimeraX-SDF: 2.0
ChimeraX-Segger: 1.0
ChimeraX-Segment: 1.0
ChimeraX-SelInspector: 1.0
ChimeraX-SeqView: 2.4.6
ChimeraX-Shape: 1.0.1
ChimeraX-Shell: 1.0
ChimeraX-Shortcuts: 1.1
ChimeraX-ShowAttr: 1.0
ChimeraX-ShowSequences: 1.0
ChimeraX-SideView: 1.0
ChimeraX-Smiles: 2.1
ChimeraX-SmoothLines: 1.0
ChimeraX-SpaceNavigator: 1.0
ChimeraX-StdCommands: 1.6
ChimeraX-STL: 1.0
ChimeraX-Storm: 1.0
ChimeraX-Struts: 1.0
ChimeraX-Surface: 1.0
ChimeraX-SwapAA: 2.0
ChimeraX-SwapRes: 2.1
ChimeraX-TapeMeasure: 1.0
ChimeraX-Test: 1.0
ChimeraX-Toolbar: 1.1
ChimeraX-ToolshedUtils: 1.2
ChimeraX-Tug: 1.0
ChimeraX-UI: 1.13.7
ChimeraX-uniprot: 2.2
ChimeraX-UnitCell: 1.0
ChimeraX-ViewDockX: 1.0.1
ChimeraX-VIPERdb: 1.0
ChimeraX-Vive: 1.1
ChimeraX-VolumeMenu: 1.0
ChimeraX-VTK: 1.0
ChimeraX-WavefrontOBJ: 1.0
ChimeraX-WebCam: 1.0
ChimeraX-WebServices: 1.0
ChimeraX-Zone: 1.0
colorama: 0.4.4
cxservices: 1.1
cycler: 0.11.0
Cython: 0.29.24
decorator: 5.1.0
distro: 1.6.0
docutils: 0.17.1
filelock: 3.0.12
funcparserlib: 0.3.6
grako: 3.16.5
h5py: 3.5.0
html2text: 2020.1.16
idna: 3.3
ihm: 0.21
imagecodecs: 2021.4.28
imagesize: 1.3.0
ipykernel: 5.5.5
ipython: 7.23.1
ipython-genutils: 0.2.0
jedi: 0.18.0
Jinja2: 3.0.1
jupyter-client: 6.1.12
jupyter-core: 4.9.1
kiwisolver: 1.3.2
line-profiler: 3.3.0
lxml: 4.6.3
lz4: 3.1.3
MarkupSafe: 2.0.1
matplotlib: 3.4.3
matplotlib-inline: 0.1.3
msgpack: 1.0.2
netCDF4: 1.5.7
networkx: 2.6.3
numexpr: 2.7.3
numpy: 1.21.2
openvr: 1.16.801
packaging: 21.2
ParmEd: 3.2.0
parso: 0.8.2
pexpect: 4.8.0
pickleshare: 0.7.5
Pillow: 8.3.2
pip: 21.2.4
pkginfo: 1.7.1
prompt-toolkit: 3.0.22
psutil: 5.8.0
ptyprocess: 0.7.0
pycollada: 0.7.1
pydicom: 2.1.2
Pygments: 2.10.0
PyOpenGL: 3.1.5
PyOpenGL-accelerate: 3.1.5
pyparsing: 2.4.7
PyQt5-commercial: 5.15.2
PyQt5-sip: 12.8.1
PyQtWebEngine-commercial: 5.15.2
python-dateutil: 2.8.2
pytz: 2021.3
pyzmq: 22.3.0
qtconsole: 5.1.1
QtPy: 1.11.2
RandomWords: 0.3.0
requests: 2.26.0
scipy: 1.7.1
setuptools: 57.5.0
sfftk-rw: 0.7.1
six: 1.16.0
snowballstemmer: 2.1.0
sortedcontainers: 2.4.0
Sphinx: 4.2.0
sphinx-autodoc-typehints: 1.12.0
sphinxcontrib-applehelp: 1.0.2
sphinxcontrib-blockdiag: 2.0.0
sphinxcontrib-devhelp: 1.0.2
sphinxcontrib-htmlhelp: 2.0.0
sphinxcontrib-jsmath: 1.0.1
sphinxcontrib-qthelp: 1.0.3
sphinxcontrib-serializinghtml: 1.1.5
suds-jurko: 0.6
tables: 3.6.1
tifffile: 2021.4.8
tinyarray: 1.2.3
tornado: 6.1
traitlets: 5.1.1
urllib3: 1.26.7
wcwidth: 0.2.5
webcolors: 1.11.1
wheel: 0.37.0
wheel-filename: 1.3.0
Change History (2)
comment:1 by , 4 years ago
| Cc: | added |
|---|---|
| Component: | Unassigned → Sequence |
| Owner: | set to |
| Platform: | → all |
| Project: | → ChimeraX |
| Status: | new → assigned |
| Summary: | ChimeraX bug report submission → Blast results problem: 'NoneType' object has no attribute 'split' |
comment:2 by , 4 years ago
| Resolution: | → fixed |
|---|---|
| Status: | assigned → closed |
Note:
See TracTickets
for help on using tickets.
Duplicate of #5579
Thank you for this bug report. I believe the issue was fixed in a recent
daily build, so updating to the latest daily build should resolve the
issue. If it doesn't, please don't hesitate to reopen this ticket, or file
another bug report.