Context Navigation

← Previous Change
Ticket History
Next Change →

Changes between Initial Version and Version 1 of Ticket #20389

Timestamp:: May 26, 2026, 10:00:05 AM (13 hours ago)
Author:: Eric Pettersen
Comment:

Legend:

: Unmodified
: Added
: Removed
: Modified

Ticket #20389
- Property Component Unassigned → Sequence
- Property Owner set to Zach Pearson
- Property Platform → all
- Property Project → ChimeraX
- Property Status new → assigned
- Property Summary ChimeraX bug report submission → Parsing BlastProtein results failed: HTTP Error 415: Unsupported Media Type

Ticket #20389 – Description

-              initial
+              v1
 Alignment of 6cm4 chain A to query has RMSD 1.02 using 55 of 126 paired
 residues within cutoff distance 2.0
+Fetching compressed mmCIF 3g3x from http://files.rcsb.org/download/3g3x.cif
+g3x title:
+Crystal structure of spin labeled T4 Lysozyme (T151R1) at 100 K [more info...]
+Chain information for 3g3x #46
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3g3x #46
+---
+AZI — azide ion
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
+methanesulfonothioate (MTSL)
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3g3x chain A to query has RMSD 0.973 using 49 of 126 paired
+residues within cutoff distance 2.0
+zyt title:
+Crystal structure of spin labeled T4 Lysozyme (A82R1) [more info...]
+Chain information for 1zyt #47
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 1zyt #47
+---
+AZI — azide ion
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
+methanesulfonothioate (MTSL)
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 104 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 1zyt chain A to query has RMSD 0.98 using 50 of 124 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 3sb8 from http://files.rcsb.org/download/3sb8.cif
+sb8 title:
+Cu-mediated Dimer of T4 Lysozyme D61H/K65H by Synthetic Symmetrization [more
+info...]
+Chain information for 3sb8 #48
+---
+Chain | Description | UniProt
+A B C | Lysozyme | LYS_BPT4 1-162
+Non-standard residues in 3sb8 #48
+---
+CU — copper (II) ion
+sb8 mmCIF Assemblies
+---
+| author_and_software_defined_assembly
+| author_and_software_defined_assembly
+Deleted 2 extra chains, 9 C-terminal residues, 5 N-terminal residues, 9 non-
+polymer residues more than 3.0 Angstroms away.
+Alignment of 3sb8 chain A to query has RMSD 0.981 using 49 of 127 paired
+residues within cutoff distance 2.0
+l title:
+The response of T4 lysozyme to large-to-small substitutions within the core
+and its relation to the hydrophobic effect [more info...]
+Chain information for 238l #49
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 238l #49
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 238l chain A to query has RMSD 0.934 using 46 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1p46 from http://files.rcsb.org/download/1p46.cif
+p46 title:
+T4 lysozyme core repacking mutant M106I/TA [more info...]
+Chain information for 1p46 #50
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1p46 #50
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+K — potassium ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 116 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 1p46 chain A to query has RMSD 0.99 using 52 of 125 paired
+residues within cutoff distance 2.0
+l65 title:
+Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A
+polyalanine α-helix containing ten consecutive alanines [more info...]
+Chain information for 1l65 #51
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l65 #51
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 53 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l65 chain A to query has RMSD 1.01 using 49 of 124 paired
+residues within cutoff distance 2.0
+g0k title:
+Crystal structure of T4 lysozyme mutant T152C [more info...]
+Chain information for 1g0k #52
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 1g0k #52
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 11 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1g0k chain A to query has RMSD 0.999 using 49 of 125 paired
+residues within cutoff distance 2.0
+gtm title:
+Corticotropin-releasing hormone receptor 1(CRF1R) bound with BMK-C203 by XFEL
+[more info...]
+Chain information for 8gtm #53
+---
+Chain | Description | UniProt
+A | Isoform CRF-R2 of Corticotropin-releasing factor receptor 1 | CRFR1_HUMAN 104-373
+B | Endolysin | A0A346FJK3_BPT6 1000-1159
+Non-standard residues in 8gtm #53
+---
+VI — 7-(4-bromanyl-2,6-dimethoxy-
+phenyl)-4,8-dimethyl-~{N},~{N}-bis[4,4,4-tris(fluoranyl)butyl]-1$l^{4},3,5,9-tetrazabicyclo[4.3.0]nona-1(6),2,4,8-tetraen-2-amine
+Deleted 1 extra chains, 8 C-terminal residues, 1 N-terminal residues, 1 non-
+polymer residues more than 3.0 Angstroms away.
+Alignment of 8gtm chain B to query has RMSD 1.28 using 69 of 126 paired
+residues within cutoff distance 2.0
+sba title:
+Zn-mediated Hexamer of T4 Lysozyme R76H/R80H by Synthetic Symmetrization [more
+info...]
+Chain information for 3sba #54
+---
+Chain | Description | UniProt
+A B C D E F | Lysozyme | LYS_BPT4 1-162
+Non-standard residues in 3sba #54
+---
+CL — chloride ion
+ZN — zinc ion
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 5 extra chains, 9 C-terminal residues, 3 N-terminal residues, 6 non-
+polymer residues more than 3.0 Angstroms away.
+Alignment of 3sba chain E to query has RMSD 1.35 using 57 of 127 paired
+residues within cutoff distance 2.0
+c8r title:
+Contributions of all 20 amino acids at site 96 to stability and structure of
+T4 lysozyme [more info...]
+Chain information for 3c8r #55
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3c8r #55
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 22 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3c8r chain A to query has RMSD 1 using 48 of 125 paired residues
+within cutoff distance 2.0
+ntg title:
+Structure of Spin-labeled T4 Lysozyme Mutant T115R7 [more info...]
+Chain information for 2ntg #56
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 2ntg #56
+---
+BME — β-mercaptoethanol
+R7A —
+S-[(4-bromo-1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
+methanesulfonothioate
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 122 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 2ntg chain A to query has RMSD 0.999 using 50 of 124 paired
+residues within cutoff distance 2.0
+g06 title:
+Crystal structure of T4 lysozyme mutant V149S [more info...]
+Chain information for 1g06 #57
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 1g06 #57
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1g06 chain A to query has RMSD 0.994 using 48 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 177l from http://files.rcsb.org/download/177l.cif
+l title:
+Protein flexibility and adaptability seen in 25 crystal forms of T4 LYSOZYME
+[more info...]
+Chain information for 177l #58
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 9 C-terminal residues, 2 N-terminal residues, 3 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 177l chain A to query has RMSD 0.986 using 46 of 125 paired
+residues within cutoff distance 2.0
+l title:
+The energetic cost and the structural consequences of burying A hydroxyl group
+within the core of A protein determined from ala to ser and val to THR
+substitutions In T4 lysozyme [more info...]
+Chain information for 122l #59
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 122l #59
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 122l chain A to query has RMSD 1.03 using 50 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 103l from http://files.rcsb.org/download/103l.cif
+l title:
+How amino-acid insertions are allowed In an α-helix of T4 lysozyme [more
+info...]
+Chain information for 103l #60
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 103l #60
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 103l chain A to query has RMSD 0.898 using 45 of 124 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 5kio from http://files.rcsb.org/download/5kio.cif
+kio title:
+Pseudo T4 lysozyme mutant - Y18PHE-I [more info...]
+Chain information for 5kio #61
+---
+Chain | Description | UniProt
+A | Endolysin | ENLYS_BPT4 1-164
+Non-standard residues in 5kio #61
+---
+HED — 2-hydroxyethyl disulfide
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 9 C-terminal residues, 2 N-terminal residues, 133 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 5kio chain A to query has RMSD 0.971 using 48 of 126 paired
+residues within cutoff distance 2.0
+pbl title:
+Structure of the human dopamine D3 receptor in complex with eticlopride [more
+info...]
+Chain information for 3pbl #62
+---
+Chain | Description | UniProt
+A B | D(3) dopamine receptor, Lysozyme chimera | DRD3_HUMAN 2-221 319-400, LYS_BPT4 1002-1161
+Non-standard residues in 3pbl #62
+---
+ETQ —
+-chloro-5-ethyl-N-{[(2S)-1-ethylpyrrolidin-2-yl]methyl}-6-hydroxy-2-methoxybenzamide
+GLC — alpha-D-glucopyranose (alpha-D-glucose; D-glucose; glucose)
+pbl mmCIF Assemblies
+---
+| software_defined_assembly
+| software_defined_assembly
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 1 extra chains, 90 C-terminal residues, 191 N-terminal residues, 4
+non-polymer residues more than 3.0 Angstroms away.
+Alignment of 3pbl chain A to query has RMSD 0.95 using 47 of 127 paired
+residues within cutoff distance 2.0
+p2l title:
+T4 Lysozyme Core Repacking Mutant V87I/TA [more info...]
+Chain information for 1p2l #63
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1p2l #63
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+K — potassium ion
+PO4 — phosphate ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 114 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 1p2l chain A to query has RMSD 0.943 using 48 of 124 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1l82 from http://files.rcsb.org/download/1l82.cif
+l82 title:
+Design and structural analysis of alternative hydrophobic core packing
+arrangements In bacteriophage T4 lysozyme [more info...]
+Chain information for 1l82 #64
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l82 #64
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l82 chain A to query has RMSD 1.01 using 48 of 124 paired
+residues within cutoff distance 2.0
+l36 title:
+Toward A simplification of the protein folding problem: A stabilizing
+polyalanine α-helix engineered In T4 lysozyme [more info...]
+Chain information for 1l36 #65
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1l36 #65
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l36 chain A to query has RMSD 1.02 using 47 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Control of enzyme activity by an engineered disulfide bond [more info...]
+Chain information for 162l #66
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 162l #66
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 162l chain A to query has RMSD 0.995 using 48 of 125 paired
+residues within cutoff distance 2.0
+pbl title:
+Structure of the human dopamine D3 receptor in complex with eticlopride [more
+info...]
+Chain information for 3pbl #67
+---
+Chain | Description | UniProt
+A B | D(3) dopamine receptor, Lysozyme chimera | DRD3_HUMAN 2-221 319-400, LYS_BPT4 1002-1161
+Non-standard residues in 3pbl #67
+---
+ETQ —
+-chloro-5-ethyl-N-{[(2S)-1-ethylpyrrolidin-2-yl]methyl}-6-hydroxy-2-methoxybenzamide
+GLC — alpha-D-glucopyranose (alpha-D-glucose; D-glucose; glucose)
+pbl mmCIF Assemblies
+---
+| software_defined_assembly
+| software_defined_assembly
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 1 extra chains, 90 C-terminal residues, 167 N-terminal residues, 5
+non-polymer residues more than 3.0 Angstroms away.
+Alignment of 3pbl chain B to query has RMSD 1 using 46 of 142 paired residues
+within cutoff distance 2.0
+l title:
+T4 lysozyme mutant M120K [more info...]
+Chain information for 232l #68
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 232l #68
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 232l chain A to query has RMSD 0.973 using 48 of 125 paired
+residues within cutoff distance 2.0
+tla title:
+Hydrophobic core repacking and aromatic-aromatic interaction In the
+thermostable mutant of T4 lysozyme ser 117 (right arrow) phe [more info...]
+Chain information for 1tla #69
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1tla #69
+---
+CL — chloride ion
+PO4 — phosphate ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1tla chain A to query has RMSD 1.04 using 50 of 125 paired
+residues within cutoff distance 2.0
+g0g title:
+Crystal structure of T4 lysozyme mutant T152A [more info...]
+Chain information for 1g0g #70
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 1g0g #70
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1g0g chain A to query has RMSD 0.987 using 49 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
+[more info...]
+Chain information for 172l #71
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 172l #71
+---
+BME — β-mercaptoethanol
+Deleted 11 C-terminal residues, 2 N-terminal residues, 20 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 172l chain A to query has RMSD 1.26 using 69 of 124 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 5w0p from http://files.rcsb.org/download/5w0p.cif
+w0p title:
+Crystal structure of rhodopsin bound to visual arrestin determined by X-ray
+free electron laser [more info...]
+Chain information for 5w0p #72
+---
+Chain | Description | UniProt
+A B C D | Endolysin,Rhodopsin,S-arrestin | A0A097J792_BPT4 -159-0, OPSD_HUMAN 1-1994, ARRS_MOUSE 2010-2392
+Non-standard residues in 5w0p #72
+---
+NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine;
+-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose;
+-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE)
+w0p mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+| author_defined_assembly
+| author_defined_assembly
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 3 extra chains, 698 C-terminal residues, 8 non-polymer residues more
+than 3.0 Angstroms away.
+Alignment of 5w0p chain C to query has RMSD 1.33 using 53 of 126 paired
+residues within cutoff distance 2.0
+l72 title:
+Multiple stabilizing alanine replacements within α-helix 126-134 of T4
+lysozyme have independent, additive effects on both structure and stability
+[more info...]
+Chain information for 1l72 #73
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1l72 #73
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l72 chain A to query has RMSD 0.89 using 44 of 125 paired
+residues within cutoff distance 2.0
+i6s title:
+T4 lysozyme mutant C54T/C97A/N101A [more info...]
+Chain information for 1i6s #74
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1i6s #74
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1i6s chain A to query has RMSD 1.04 using 50 of 125 paired
+residues within cutoff distance 2.0
+g0p title:
+Crystal structure of T4 lysozyme mutant V149G [more info...]
+Chain information for 1g0p #75
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 1g0p #75
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1g0p chain A to query has RMSD 1.02 using 48 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 167l from http://files.rcsb.org/download/167l.cif
+l title:
+Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
+[more info...]
+Chain information for 167l #76
+---
+Chain | Description | UniProt
+A B | T4 LYSOZYME | LYS_BPT4 1-163
+l mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 28 non-
+polymer residues more than 3.0 Angstroms away.
+Alignment of 167l chain A to query has RMSD 1.02 using 48 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Role of backbone flexibility In the accommodation of variants that repack the
+core of T4 lysozyme [more info...]
+Chain information for 146l #77
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 146l #77
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 146l chain A to query has RMSD 0.981 using 47 of 127 paired
+residues within cutoff distance 2.0
+kii title:
+Pseudo T4 lysozyme mutant - Y88PHE-methyl [more info...]
+Chain information for 5kii #78
+---
+Chain | Description | UniProt
+A | Endolysin | ENLYS_BPT4 1-164
+Non-standard residues in 5kii #78
+---
+HED — 2-hydroxyethyl disulfide
+PO4 — phosphate ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Hit structure sequence 5kii_A amino acid F at sequence position 87 does not
+match sequence alignment D at position 85. Structure sequence
+MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVFDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNLHHHHHH.
+Alignment sequence
+IFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTF.
+Deleted 10 C-terminal residues, 2 N-terminal residues, 186 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 5kii chain A to query has RMSD 1.21 using 25 of 124 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 4yc4 from http://files.rcsb.org/download/4yc4.cif
+Fetching CCD M59 from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/9/M59/M59.cif
+yc4 title:
+Crystal structure of phosphatidyl inositol 4-kinase II α in complex with
+nucleotide analog [more info...]
+Chain information for 4yc4 #79
+---
+Chain | Description | UniProt
+A | Phosphatidylinositol 4-kinase type 2-alpha,Lysozyme,Phosphatidylinositol 4-kinase type 2-alpha | P4K2A_HUMAN 76-172 180-468, D9IEF7_BPT4 1004-1166
+Non-standard residues in 4yc4 #79
+---
+ADP — adenosine-5'-diphosphate
+M59 — [(1S,3S,4S)-3-(6-amino-9H-purin-9-yl)bicyclo[2.2.1]hept-1-yl]methanol
+Deleted 259 C-terminal residues, 73 N-terminal residues, 5 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 4yc4 chain A to query has RMSD 0.805 using 43 of 129 paired
+residues within cutoff distance 2.0
+l64 title:
+T4 Lysozyme S44E/WT* [more info...]
+Chain information for 3l64 #80
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3l64 #80
+---
+BME — β-mercaptoethanol
+Deleted 11 C-terminal residues, 2 N-terminal residues, 37 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3l64 chain A to query has RMSD 0.93 using 45 of 127 paired
+residues within cutoff distance 2.0
+l title:
+The response of T4 lysozyme to large-to-small substitutions within the core
+and its relation to the hydrophobic effect [more info...]
+Chain information for 237l #81
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 237l #81
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 11 C-terminal residues, 2 N-terminal residues, 81 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 237l chain A to query has RMSD 1.02 using 49 of 125 paired
+residues within cutoff distance 2.0
+l67 title:
+Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A
+polyalanine α-helix containing ten consecutive alanines [more info...]
+Chain information for 1l67 #82
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l67 #82
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 7 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l67 chain A to query has RMSD 0.972 using 48 of 127 paired
+residues within cutoff distance 2.0
+l53 title:
+Structural and thermodynamic analysis of the packing of two α-helices In
+bacteriophage T4 lysozyme [more info...]
+Chain information for 1l53 #83
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1l53 #83
+---
+BME — β-mercaptoethanol
+Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l53 chain A to query has RMSD 0.877 using 44 of 125 paired
+residues within cutoff distance 2.0
+l40 title:
+Contributions of engineered surface salt bridges to the stability of T4
+lysozyme determined by directed mutagenesis [more info...]
+Chain information for 1l40 #84
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l40 chain A to query has RMSD 0.936 using 46 of 125 paired
+residues within cutoff distance 2.0
+l18 title:
+Hydrophobic stabilization In T4 lysozyme determined directly by multiple
+substitutions of ile 3 [more info...]
+Chain information for 1l18 #85
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l18 chain A to query has RMSD 1.02 using 49 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Control of enzyme activity by an engineered disulfide bond [more info...]
+Chain information for 155l #86
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 155l #86
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 155l chain A to query has RMSD 1.01 using 48 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 152l from http://files.rcsb.org/download/152l.cif
+l title:
+Conservation of solvent-binding sites In 10 crystal forms of T4 lysozyme [more
+info...]
+Chain information for 152l #87
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-163
+Non-standard residues in 152l #87
+---
+SO4 — sulfate ion
+Deleted 11 C-terminal residues, 2 N-terminal residues, 22 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 152l chain A to query has RMSD 0.866 using 42 of 127 paired
+residues within cutoff distance 2.0
+Atom D1 is not in the residue template for MET /A:1
+Atom D is not in the residue template for ASN /A:2
+Atom D is not in the residue template for ILE /A:3
+Atom D is not in the residue template for PHE /A:4
+Atom D is not in the residue template for GLU /A:5
+Atom D is not in the residue template for ALA /A:6
+Atom D is not in the residue template for LEU /A:7
+Atom D is not in the residue template for ARG /A:8
+Atom D is not in the residue template for ILE /A:9
+Too many hydrogens missing from residue template(s) to warn about
+u0e title:
+Neutron crystal structure of T4L M6AE [more info...]
+Chain information for 6u0e #88
+---
+Chain | Description | UniProt
+A | Endolysin | D9IEF7_BPT4 1-164
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues.
+Alignment of 6u0e chain A to query has RMSD 1.03 using 48 of 126 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 6u0c from http://files.rcsb.org/download/6u0c.cif
+Atom D1 is not in the residue template for MET /A:1
+Atom D is not in the residue template for ASN /A:2
+Atom D is not in the residue template for ILE /A:3
+Atom D is not in the residue template for PHE /A:4
+Atom D is not in the residue template for GLU /A:5
+Atom D is not in the residue template for MET /A:6
+Atom D is not in the residue template for LEU /A:7
+Atom D is not in the residue template for ARG /A:8
+Atom D is not in the residue template for ILE /A:9
+Too many hydrogens missing from residue template(s) to warn about
+u0c title:
+Neutron crystal structure of wtT4LE [more info...]
+Chain information for 6u0c #89
+---
+Chain | Description | UniProt
+A | Endolysin | D9IEF7_BPT4 1-164
+Non-standard residues in 6u0c #89
+---
+CL — chloride ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 1 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 6u0c chain A to query has RMSD 0.988 using 48 of 126 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 4djh from http://files.rcsb.org/download/4djh.cif
+Fetching CCD JDC from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/C/JDC/JDC.cif
+djh title:
+Structure of the human κ opioid receptor in complex with JDTic [more info...]
+Chain information for 4djh #90
+---
+Chain | Description | UniProt
+A B | Kappa-type opioid receptor, Lysozyme | OPRK_HUMAN 43-261 263-358, LYS_BPT4 1002-1161
+Non-standard residues in 4djh #90
+---
+CIT — citric acid
+JDC —
+(3R)-7-hydroxy-N-{(2S)-1-[(3R,4R)-4-(3-hydroxyphenyl)-3,4-dimethylpiperidin-1-yl]-3-methylbutan-2-yl}-1,2,3,4-tetrahydroisoquinoline-3-carboxamide
+OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
+PEG — di(hydroxyethyl)ether
+djh mmCIF Assemblies
+---
+| software_defined_assembly
+| software_defined_assembly
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 1 extra chains, 88 C-terminal residues, 192 N-terminal residues, 29
+non-polymer residues more than 3.0 Angstroms away.
+Alignment of 4djh chain A to query has RMSD 1.34 using 54 of 141 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 3fa0 from http://files.rcsb.org/download/3fa0.cif
+fa0 title:
+Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the
+Temperature Sensitive T4 Lysozyme Mutant Arg96-->His [more info...]
+Chain information for 3fa0 #91
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-162
+Non-standard residues in 3fa0 #91
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+K — potassium ion
+PO4 — phosphate ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 9 C-terminal residues, 2 N-terminal residues, 103 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3fa0 chain A to query has RMSD 0.991 using 50 of 125 paired
+residues within cutoff distance 2.0
+ray title:
+beta-chlorophenetole in complex with T4 lysozyme L99A [more info...]
+Chain information for 2ray #92
+---
+Chain | Description | UniProt
+X | Lysozyme | LYS_BPT4 1-162
+Non-standard residues in 2ray #92
+---
+— (2-chloroethoxy)benzene
+PO4 — phosphate ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 9 C-terminal residues, 2 N-terminal residues, 93 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 2ray chain X to query has RMSD 0.931 using 48 of 124 paired
+residues within cutoff distance 2.0
+l title:
+AN adaptable metal-binding site engineered INTO T4 lysozyme [more info...]
+Chain information for 260l #93
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 260l #93
+---
+CL — chloride ion
+NI — nickel (II) ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 260l chain A to query has RMSD 0.86 using 43 of 126 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1l86 from http://files.rcsb.org/download/1l86.cif
+l86 title:
+Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
+lysozyme have different structural and thermodynamic consequences [more
+info...]
+Chain information for 1l86 #94
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l86 #94
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l86 chain A to query has RMSD 0.866 using 46 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 7z36 from http://files.rcsb.org/download/7z36.cif
+z36 title:
+Crystal structure of the KAP1 tripartite motif in complex with the ZNF93 KRAB
+domain [more info...]
+Chain information for 7z36 #95
+---
+Chain | Description | UniProt
+A B | Endolysin,Transcription intermediary factor 1-beta,Isoform 2 of Transcription intermediary factor 1-beta | ENLYS_BPT4 26-185, TIF1B_HUMAN 187-271, TIF1B-2_HUMAN 272-482
+C S | SMARCAD1 CUE1 domain |
+D | Zinc finger protein 93 | ZNF93_HUMAN 2-71
+Non-standard residues in 7z36 #95
+---
+ZN — zinc ion
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 4 extra chains, 272 C-terminal residues, 8 non-polymer residues more
+than 3.0 Angstroms away.
+Alignment of 7z36 chain A to query has RMSD 0.913 using 46 of 134 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 6pgy from http://files.rcsb.org/download/6pgy.cif
+pgy title:
+MTSL labelled T4 lysozyme pseudo-wild type K65C mutant [more info...]
+Chain information for 6pgy #96
+---
+Chain | Description | UniProt
+A | Endolysin | D9IEF7_BPT4 1-164
+Non-standard residues in 6pgy #96
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
+methanesulfonothioate (MTSL)
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 9 C-terminal residues, 2 N-terminal residues, 32 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 6pgy chain A to query has RMSD 0.98 using 47 of 126 paired
+residues within cutoff distance 2.0
+l title:
+Lysozyme [more info...]
+Chain information for 254l #97
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 254l #97
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 11 C-terminal residues, 2 N-terminal residues, 84 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 254l chain A to query has RMSD 0.98 using 48 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Protein structure plasticity exemplified by insertion and deletion mutants In
+T4 lysozyme [more info...]
+Chain information for 213l #98
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 9 C-terminal residues, 2 N-terminal residues, 46 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 213l chain A to query has RMSD 0.987 using 48 of 125 paired
+residues within cutoff distance 2.0
+l88 title:
+Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
+lysozyme have different structural and thermodynamic consequences [more
+info...]
+Chain information for 1l88 #99
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l88 #99
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l88 chain A to query has RMSD 1.07 using 50 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Structural basis of α-helix propensity At two sites In T4 lysozyme [more
+info...]
+Chain information for 114l #100
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 114l #100
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 114l chain A to query has RMSD 1 using 48 of 125 paired residues
+within cutoff distance 2.0
+l title:
+How amino-acid insertions are allowed In an α-helix of T4 lysozyme [more
+info...]
+Chain information for 102l #101
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 102l #101
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 102l chain A to query has RMSD 1 using 48 of 125 paired residues
+within cutoff distance 2.0
+djh title:
+Structure of the human κ opioid receptor in complex with JDTic [more info...]
+Chain information for 4djh #102
+---
+Chain | Description | UniProt
+A B | Kappa-type opioid receptor, Lysozyme | OPRK_HUMAN 43-261 263-358, LYS_BPT4 1002-1161
+Non-standard residues in 4djh #102
+---
+CIT — citric acid
+JDC —
+(3R)-7-hydroxy-N-{(2S)-1-[(3R,4R)-4-(3-hydroxyphenyl)-3,4-dimethylpiperidin-1-yl]-3-methylbutan-2-yl}-1,2,3,4-tetrahydroisoquinoline-3-carboxamide
+OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
+PEG — di(hydroxyethyl)ether
+djh mmCIF Assemblies
+---
+| software_defined_assembly
+| software_defined_assembly
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 1 extra chains, 88 C-terminal residues, 199 N-terminal residues, 30
+non-polymer residues more than 3.0 Angstroms away.
+Alignment of 4djh chain B to query has RMSD 0.918 using 47 of 134 paired
+residues within cutoff distance 2.0
+fad title:
+Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the
+Temperature Sensitive T4 Lysozyme Mutant Arg96-->His [more info...]
+Chain information for 3fad #103
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3fad #103
+---
+BME — β-mercaptoethanol
+PO4 — phosphate ion
+fad mmCIF Assemblies
+---
+| author_defined_assembly
+| software_defined_assembly
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 103 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 3fad chain A to query has RMSD 0.971 using 46 of 122 paired
+residues within cutoff distance 2.0
+qt6 title:
+E11H Mutant of T4 Lysozyme [more info...]
+Chain information for 1qt6 #104
+---
+Chain | Description | UniProt
+A | PROTEIN (T4 LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 1qt6 #104
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1qt6 chain A to query has RMSD 1.07 using 50 of 125 paired
+residues within cutoff distance 2.0
+qs9 title:
+The introduction of strain and its effects on the structure and stability of
+T4 lysozyme [more info...]
+Chain information for 1qs9 #105
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-162
+Deleted 9 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1qs9 chain A to query has RMSD 1.06 using 49 of 125 paired
+residues within cutoff distance 2.0
+p36 title:
+T4 lyoszyme core repacking mutant I100V/Ta [more info...]
+Chain information for 1p36 #106
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1p36 #106
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+K — potassium ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 104 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 1p36 chain A to query has RMSD 0.987 using 50 of 124 paired
+residues within cutoff distance 2.0
+l32 title:
+Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
+protein stability [more info...]
+Chain information for 1l32 #107
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l32 chain A to query has RMSD 1.02 using 48 of 127 paired
+residues within cutoff distance 2.0
+w0p title:
+Crystal structure of rhodopsin bound to visual arrestin determined by X-ray
+free electron laser [more info...]
+Chain information for 5w0p #108
+---
+Chain | Description | UniProt
+A B C D | Endolysin,Rhodopsin,S-arrestin | A0A097J792_BPT4 -159-0, OPSD_HUMAN 1-1994, ARRS_MOUSE 2010-2392
+Non-standard residues in 5w0p #108
+---
+NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine;
+-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose;
+-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE)
+w0p mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+| author_defined_assembly
+| author_defined_assembly
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 3 extra chains, 697 C-terminal residues, 8 non-polymer residues more
+than 3.0 Angstroms away.
+Alignment of 5w0p chain A to query has RMSD 0.939 using 41 of 126 paired
+residues within cutoff distance 2.0
+cdv title:
+Contributions of all 20 amino acids at site 96 to the stability and structure
+of T4 lysozyme [more info...]
+Chain information for 3cdv #109
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3cdv #109
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3cdv chain A to query has RMSD 1 using 49 of 125 paired residues
+within cutoff distance 2.0
+l title:
+How amino-acid insertions are allowed In an α-helix of T4 lysozyme [more
+info...]
+Chain information for 201l #110
+---
+Chain | Description | UniProt
+A B | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 201l #110
+---
+BME — β-mercaptoethanol
+l mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 94 non-
+polymer residues more than 3.0 Angstroms away.
+Alignment of 201l chain A to query has RMSD 0.907 using 46 of 125 paired
+residues within cutoff distance 2.0
+c6n title:
+T4 lysozyme mutant C54T/C97A/L99A/F153A In the presence of 8 atm xenon [more
+info...]
+Chain information for 1c6n #111
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164
+Non-standard residues in 1c6n #111
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+XE — XENON
+Deleted 10 C-terminal residues, 2 N-terminal residues, 51 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1c6n chain A to query has RMSD 1.01 using 50 of 124 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 5t04 from http://files.rcsb.org/download/5t04.cif
+Fetching CCD TCE from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/E/TCE/TCE.cif
+t04 title:
+Structure of constitutively active neurotensin receptor [more info...]
+Chain information for 5t04 #112
+---
+Chain | Description | UniProt
+A | Neurotensin receptor type 1,Endolysin,Neurotensin receptor type 1 | NTR1_RAT 43-268 297-396, ENLYS_BPT4 1002-1161
+B | ARG-ARG-PRO-TYR-ILE-LEU |
+Non-standard residues in 5t04 #112
+---
+GOL — glycerol (glycerin; propane-1,2,3-triol)
+PEG — di(hydroxyethyl)ether
+TCE — 3,3',3''-phosphanetriyltripropanoic acid
+(3-[bis(2-carboxyethyl)phosphanyl]propanoic acid)
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 1 extra chains, 88 C-terminal residues, 215 N-terminal residues, 4
+non-polymer residues more than 3.0 Angstroms away.
+Alignment of 5t04 chain A to query has RMSD 1.24 using 57 of 129 paired
+residues within cutoff distance 2.0
+g0j title:
+Crystal structure of T4 lysozyme mutant T152S [more info...]
+Chain information for 1g0j #113
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 1g0j #113
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1g0j chain A to query has RMSD 1 using 49 of 125 paired residues
+within cutoff distance 2.0
+Fetching compressed mmCIF 4pla from http://files.rcsb.org/download/4pla.cif
+pla title:
+Crystal structure of phosphatidyl inositol 4-kinase II α in complex with ATP
+[more info...]
+Chain information for 4pla #114
+---
+Chain | Description | UniProt
+A | Chimera protein of Phosphatidylinositol 4-kinase type 2-alpha and Lysozyme | P4K2A_HUMAN 76-172 180-468, D9IEF7_BPT4 1004-1166
+Non-standard residues in 4pla #114
+---
+ATP — adenosine-5'-triphosphate
+Deleted 256 C-terminal residues, 73 N-terminal residues, 3 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 4pla chain A to query has RMSD 0.787 using 42 of 129 paired
+residues within cutoff distance 2.0
+ou9 title:
+Structure of Spin-labeled T4 Lysozyme Mutant T115R1/R119A [more info...]
+Chain information for 2ou9 #115
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 2ou9 #115
+---
+MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
+methanesulfonothioate (MTSL)
+Deleted 11 C-terminal residues, 2 N-terminal residues.
+Alignment of 2ou9 chain A to query has RMSD 0.947 using 48 of 124 paired
+residues within cutoff distance 2.0
+qt3 title:
+T26D mutant of T4 lysozyme [more info...]
+Chain information for 1qt3 #116
+---
+Chain | Description | UniProt
+A | PROTEIN (T4 Lysozyme) | LYS_BPT4 1-164
+Non-standard residues in 1qt3 #116
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 11 C-terminal residues, 2 N-terminal residues, 87 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1qt3 chain A to query has RMSD 1.02 using 49 of 125 paired
+residues within cutoff distance 2.0
+qsb title:
+The introduction of strain and its effects on the structure and stability of
+T4 lysozyme [more info...]
+Chain information for 1qsb #117
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162
+Non-standard residues in 1qsb #117
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1qsb chain A to query has RMSD 1.03 using 49 of 125 paired
+residues within cutoff distance 2.0
+l74 title:
+Multiple stabilizing alanine replacements within α-helix 126-134 of T4
+lysozyme have independent, additive effects on both structure and stability
+[more info...]
+Chain information for 1l74 #118
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1l74 #118
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l74 chain A to query has RMSD 1.02 using 47 of 125 paired
+residues within cutoff distance 2.0
+l01 title:
+Structural studies of mutants of the lysozyme of bacteriophage T4. The
+temperature-sensitive mutant protein THR157 (right arrow) ile [more info...]
+Chain information for 1l01 #119
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l01 chain A to query has RMSD 1.04 using 49 of 124 paired
+residues within cutoff distance 2.0
+cv6 title:
+T4 lysozyme mutant V149M [more info...]
+Chain information for 1cv6 #120
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1cv6 #120
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1cv6 chain A to query has RMSD 1.06 using 50 of 127 paired
+residues within cutoff distance 2.0
+l title:
+Thermodynamic and structural compensation In "size-switch" core-repacking
+variants of T4 lysozyme [more info...]
+Chain information for 197l #121
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 197l #121
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 42 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 197l chain A to query has RMSD 0.939 using 48 of 127 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 110l from http://files.rcsb.org/download/110l.cif
+l title:
+Structural basis of α-helix propensity At two sites In T4 lysozyme [more
+info...]
+Chain information for 110l #122
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 110l #122
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 110l chain A to query has RMSD 0.928 using 46 of 125 paired
+residues within cutoff distance 2.0
+hul title:
+Crystal structure of T4 Lysozyme S44C synthetic dimer [more info...]
+Chain information for 2hul #123
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 2hul #123
+---
+GOL — glycerol (glycerin; propane-1,2,3-triol)
+SO4 — sulfate ion
+hul mmCIF Assemblies
+---
+| author_and_software_defined_assembly
+| software_defined_assembly
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 2hul chain A to query has RMSD 0.833 using 45 of 126 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1l55 from http://files.rcsb.org/download/1l55.cif
+l55 title:
+Analysis of the interaction between charged side chains and the α-helix dipole
+using designed thermostable mutants of phage T4 lysozyme [more info...]
+Chain information for 1l55 #124
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l55 #124
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l55 chain A to query has RMSD 0.894 using 45 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1d3n from http://files.rcsb.org/download/1d3n.cif
+d3n title:
+Methionine core mutation [more info...]
+Chain information for 1d3n #125
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1d3n #125
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 49 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1d3n chain A to query has RMSD 0.883 using 44 of 125 paired
+residues within cutoff distance 2.0
+c81 title:
+Mutant K85A of T4 lysozyme in wildtype background at room temperature [more
+info...]
+Chain information for 3c81 #126
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3c81 #126
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 47 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3c81 chain A to query has RMSD 0.984 using 47 of 125 paired
+residues within cutoff distance 2.0
+c7y title:
+Mutant R96A OF T4 lysozyme in wildtype background at 298K [more info...]
+Chain information for 3c7y #127
+---
+Chain | Description | UniProt
+A | lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3c7y #127
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 21 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3c7y chain A to query has RMSD 0.972 using 47 of 124 paired
+residues within cutoff distance 2.0
+l title:
+Phage T4 lysozyme [more info...]
+Chain information for 206l #128
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 206l #128
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 206l chain A to query has RMSD 1.02 using 49 of 127 paired
+residues within cutoff distance 2.0
+pqd title:
+T4 lysozyme core repacking mutant CORE10/Ta [more info...]
+Chain information for 1pqd #129
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 1pqd #129
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+K — potassium ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 103 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 1pqd chain A to query has RMSD 1.21 using 51 of 124 paired
+residues within cutoff distance 2.0
+l48 title:
+Structural and thermodynamic analysis of the packing of two α-helices In
+bacteriophage T4 lysozyme [more info...]
+Chain information for 1l48 #130
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1l48 #130
+---
+BME — β-mercaptoethanol
+Deleted 11 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l48 chain A to query has RMSD 1.01 using 47 of 125 paired
+residues within cutoff distance 2.0
+jtm title:
+Alternative Structures of a Sequence Extended T4 Lysozyme Show that the Highly
+Conserved Beta-Sheet has Weak Intrinsic Folding Propensity [more info...]
+Chain information for 1jtm #131
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1jtm #131
+---
+BME — β-mercaptoethanol
+Deleted 17 C-terminal residues, 2 N-terminal residues, 1 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1jtm chain A to query has RMSD 1.02 using 50 of 129 paired
+residues within cutoff distance 2.0
+cv3 title:
+T4 lysozyme mutant L121M [more info...]
+Chain information for 1cv3 #132
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1cv3 #132
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1cv3 chain A to query has RMSD 0.997 using 48 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Role of backbone flexibility In the accommodation of variants that repack the
+core of T4 lysozyme [more info...]
+Chain information for 147l #133
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 147l #133
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 54 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 147l chain A to query has RMSD 1.04 using 51 of 124 paired
+residues within cutoff distance 2.0
+lx8 title:
+T4 lysozyme mutant L99A [more info...]
+Chain information for 7lx8 #134
+---
+Chain | Description | UniProt
+A | Lysozyme | D9IEF7_BPT4 1-164
+Non-standard residues in 7lx8 #134
+---
+TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer)
+YGV — 1-chloro-2-(methylsulfanyl)benzene
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 9 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 7lx8 chain A to query has RMSD 0.995 using 47 of 125 paired
+residues within cutoff distance 2.0
+w56 title:
+T4 Lysozyme L99A with sec-Butylbenzene Bound [more info...]
+Chain information for 4w56 #135
+---
+Chain | Description | UniProt
+A | Endolysin | ENLYS_BPT4 1-164
+Non-standard residues in 4w56 #135
+---
+GY — (2R)-butan-2-ylbenzene (sec-Butylbenzene)
+EPE — 4-(2-hydroxyethyl)-1-piperazine ethanesulfonic acid (HEPES)
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 47 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 4w56 chain A to query has RMSD 0.904 using 43 of 124 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 3sbb from http://files.rcsb.org/download/3sbb.cif
+sbb title:
+Disulphide-mediated Tetramer of T4 Lysozyme R76C/R80C by Synthetic
+Symmetrization [more info...]
+Chain information for 3sbb #136
+---
+Chain | Description | UniProt
+C | Lysozyme | LYS_BPT4 1-162
+Non-standard residues in 3sbb #136
+---
+CL — chloride ion
+sbb mmCIF Assemblies
+---
+| author_and_software_defined_assembly
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 9 C-terminal residues, 3 N-terminal residues, 117 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3sbb chain C to query has RMSD 1.26 using 61 of 124 paired
+residues within cutoff distance 2.0
+c82 title:
+Bacteriophage lysozyme T4 lysozyme mutant K85A/R96H [more info...]
+Chain information for 3c82 #137
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3c82 #137
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3c82 chain A to query has RMSD 1.02 using 48 of 125 paired
+residues within cutoff distance 2.0
+qud title:
+L99G mutant of T4 lysozyme [more info...]
+Chain information for 1qud #138
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162
+Non-standard residues in 1qud #138
+---
+CL — chloride ion
+HEZ — hexane-1,6-diol
+Deleted 9 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1qud chain A to query has RMSD 0.961 using 46 of 127 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1p2r from http://files.rcsb.org/download/1p2r.cif
+p2r title:
+T4 lysozyme core repacking mutant I78V/Ta [more info...]
+Chain information for 1p2r #139
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1p2r #139
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+K — potassium ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 90 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1p2r chain A to query has RMSD 0.971 using 49 of 127 paired
+residues within cutoff distance 2.0
+l97 title:
+Structure of A hinge-bending bacteriophage T4 lysozyme mutant, ILE3-> pro
+[more info...]
+Chain information for 1l97 #140
+---
+Chain | Description | UniProt
+A B | T4 LYSOZYME | LYS_BPT4 1-164
+l97 mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 160
+non-polymer residues more than 3.0 Angstroms away.
+Alignment of 1l97 chain B to query has RMSD 1.18 using 53 of 122 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1l95 from http://files.rcsb.org/download/1l95.cif
+l95 title:
+Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
+lysozyme have different structural and thermodynamic consequences [more
+info...]
+Chain information for 1l95 #141
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l95 #141
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l95 chain A to query has RMSD 0.846 using 45 of 126 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1l85 from http://files.rcsb.org/download/1l85.cif
+l85 title:
+Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
+lysozyme have different structural and thermodynamic consequences [more
+info...]
+Chain information for 1l85 #142
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l85 #142
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l85 chain A to query has RMSD 0.902 using 45 of 126 paired
+residues within cutoff distance 2.0
+jtn title:
+Alternative Structures of a Sequence Extended T4 Lysozyme Show that the Highly
+Conserved Beta-Sheet Region has weak intrinsic Folding Propensity [more
+info...]
+Chain information for 1jtn #143
+---
+Chain | Description | UniProt
+A B | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1jtn #143
+---
+SO4 — sulfate ion
+jtn mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+Deleted 1 extra chains, 24 C-terminal residues, 2 N-terminal residues, 112
+non-polymer residues more than 3.0 Angstroms away.
+Alignment of 1jtn chain A to query has RMSD 0.962 using 47 of 125 paired
+residues within cutoff distance 2.0
+g0l title:
+Crystal structure of T4 lysozyme mutant T152V [more info...]
+Chain information for 1g0l #144
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 1g0l #144
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 11 C-terminal residues, 2 N-terminal residues, 91 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1g0l chain A to query has RMSD 1.01 using 49 of 124 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1d9w from http://files.rcsb.org/download/1d9w.cif
+d9w title:
+Bacteriophage T4 lysozyme mutant [more info...]
+Chain information for 1d9w #145
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 1d9w #145
+---
+BME — β-mercaptoethanol
+Deleted 9 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1d9w chain A to query has RMSD 0.959 using 46 of 127 paired
+residues within cutoff distance 2.0
+c6i title:
+T4 lysozyme mutant C54T/C97A/L99A In the presence of 8 atm argon [more
+info...]
+Chain information for 1c6i #146
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164
+Non-standard residues in 1c6i #146
+---
+AR — ARGON
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1c6i chain A to query has RMSD 0.998 using 48 of 125 paired
+residues within cutoff distance 2.0
+l title:
+The energetic cost and the structural consequences of burying A hydroxyl group
+within the core of A protein determined from ala to ser and val to THR
+substitutions In T4 lysozyme [more info...]
+Chain information for 125l #147
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 125l #147
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 125l chain A to query has RMSD 1.04 using 50 of 124 paired
+residues within cutoff distance 2.0
+l title:
+Structural basis of α-helix propensity At two sites In T4 lysozyme [more
+info...]
+Chain information for 108l #148
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 108l #148
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 81 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 108l chain A to query has RMSD 0.942 using 47 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 5v86 from http://files.rcsb.org/download/5v86.cif
+Fetching CCD 8ZA from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/A/8ZA/8ZA.cif
+v86 title:
+Structure of DCN1 bound to NAcM-OPT [more info...]
+Chain information for 5v86 #149
+---
+Chain | Description | UniProt
+A | Lysozyme,DCN1-like protein 1 | D9IEF7_BPT4 1-164, DCNL1_HUMAN 1062-1259
+Non-standard residues in 5v86 #149
+---
+ZA — N-benzyl-N-(1-butylpiperidin-4-yl)-N'-(3,4-dichlorophenyl)urea
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 196 C-terminal residues, 13 N-terminal residues, 428 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 5v86 chain A to query has RMSD 1.29 using 76 of 124 paired
+residues within cutoff distance 2.0
+l93 title:
+Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
+lysozyme have different structural and thermodynamic consequences [more
+info...]
+Chain information for 1l93 #150
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l93 #150
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 53 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l93 chain A to query has RMSD 1.08 using 50 of 124 paired
+residues within cutoff distance 2.0
+l35 title:
+Structure of A thermostable disulfide-bridge mutant of phage T4 lysozyme shows
+that an engineered crosslink In A flexible region does not increase the
+rigidity of the folded protein [more info...]
+Chain information for 1l35 #151
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-163
+Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l35 chain A to query has RMSD 1.02 using 49 of 124 paired
+residues within cutoff distance 2.0
+cv5 title:
+T4 lysozyme mutant L133M [more info...]
+Chain information for 1cv5 #152
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1cv5 #152
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 48 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1cv5 chain A to query has RMSD 1.01 using 47 of 125 paired
+residues within cutoff distance 2.0
+cdt title:
+Contributions of all 20 amino acids at site 96 to the stability and structure
+of T4 lysozyme [more info...]
+Chain information for 3cdt #153
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3cdt #153
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3cdt chain A to query has RMSD 1 using 49 of 125 paired residues
+within cutoff distance 2.0
+Fetching compressed mmCIF 3cdo from http://files.rcsb.org/download/3cdo.cif
+Fetching CCD MPD from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/D/MPD/MPD.cif
+cdo title:
+Bacteriophage T4 lysozyme mutant R96V in wildtype background at low
+temperature [more info...]
+Chain information for 3cdo #154
+---
+Chain | Description | UniProt
+A B C D | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3cdo #154
+---
+HEZ — hexane-1,6-diol
+MPD — (4S)-2-methyl-2,4-pentanediol
+SO4 — sulfate ion
+cdo mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+| author_defined_assembly
+| author_defined_assembly
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 3 extra chains, 9 C-terminal residues, 2 N-terminal residues, 674 non-
+polymer residues more than 3.0 Angstroms away.
+Alignment of 3cdo chain A to query has RMSD 1.31 using 59 of 124 paired
+residues within cutoff distance 2.0
+l title:
+Hydrolase [more info...]
+Chain information for 255l #155
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 255l #155
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 11 C-terminal residues, 2 N-terminal residues, 80 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 255l chain A to query has RMSD 1.01 using 49 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1t8f from http://files.rcsb.org/download/1t8f.cif
+t8f title:
+Crystal structure of phage T4 lysozyme mutant
+R14A/K16A/I17A/K19A/T21A/E22A/C54T/C97A [more info...]
+Chain information for 1t8f #156
+---
+Chain | Description | UniProt
+A | Lysozyme | LYCV_BPT4 1-164
+Non-standard residues in 1t8f #156
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 37 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1t8f chain A to query has RMSD 0.892 using 46 of 127 paired
+residues within cutoff distance 2.0
+llh title:
+Are carboxy terminii of helices coded by the local sequence or by tertiary
+structure contacts [more info...]
+Chain information for 1llh #157
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 1llh #157
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 17 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1llh chain A to query has RMSD 0.985 using 48 of 126 paired
+residues within cutoff distance 2.0
+l38 title:
+Contributions of engineered surface salt bridges to the stability of T4
+lysozyme determined by directed mutagenesis [more info...]
+Chain information for 1l38 #158
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l38 chain A to query has RMSD 1.03 using 49 of 125 paired
+residues within cutoff distance 2.0
+dyd title:
+Determination of α-helix propensity within the context of A folded protein:
+sites 44 and 131 In bacteriophage T4 lysozyme [more info...]
+Chain information for 1dyd #159
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1dyd #159
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 7 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1dyd chain A to query has RMSD 0.963 using 46 of 127 paired
+residues within cutoff distance 2.0
+l title:
+Control of enzyme activity by an engineered disulfide bond [more info...]
+Chain information for 161l #160
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 161l #160
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 161l chain A to query has RMSD 1.03 using 50 of 126 paired
+residues within cutoff distance 2.0
+l title:
+Structures of randomly generated mutants of T4 lysozyme show that protein
+stability can Be enhanced by relaxation of strain and by improved hydrogen
+bonding via bound solvent [more info...]
+Chain information for 131l #161
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 131l #161
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 79 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 131l chain A to query has RMSD 0.912 using 46 of 125 paired
+residues within cutoff distance 2.0
+jwy title:
+Crystal structure of A2AR-T4L in complex with 2-118 [more info...]
+Chain information for 8jwy #162
+---
+Chain | Description | UniProt
+A | Adenosine receptor A2a,Endolysin | AA2AR_HUMAN 2-208 369-463, D9IEF7_BPT4 209-368
+Non-standard residues in 8jwy #162
+---
+CLR — cholesterol
+NA — sodium ion
+OLA — oleic acid
+OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
+VBF —
+-[2-azanyl-6-[2-oxidanylidene-1-[[6-(2-oxidanylpropan-2-yl)pyridin-2-yl]methyl]pyridin-4-yl]pyrimidin-4-yl]-2-methyl-
+benzenecarbonitrile
+Deleted 97 C-terminal residues, 200 N-terminal residues, 212 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 8jwy chain A to query has RMSD 1.08 using 58 of 126 paired
+residues within cutoff distance 2.0
+loc title:
+T4 lysozyme mutant L99A in complex with 1-bromanyl-4-fluoranyl-benzene [more
+info...]
+Chain information for 7loc #163
+---
+Chain | Description | UniProt
+A | Lysozyme | D9IEF7_BPT4 1-164
+Non-standard residues in 7loc #163
+---
+BME — β-mercaptoethanol
+TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer)
+Y87 — 1-bromanyl-4-fluoranyl-benzene
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 10 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 7loc chain A to query has RMSD 0.947 using 45 of 125 paired
+residues within cutoff distance 2.0
+zg4 title:
+Structure of M1-StaR-T4L in complex with HTL0009936 at 2.35A [more info...]
+Chain information for 6zg4 #164
+---
+Chain | Description | UniProt
+A | Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1 | ACM1_HUMAN 27-219 354-438, ENLYS_BPT4 1002-1161
+Non-standard residues in 6zg4 #164
+---
+OLA — oleic acid
+PGE — triethylene glycol
+PO4 — phosphate ion
+QK8 — ethyl
+(4~{S})-4-[4-[(1-methylcyclobutyl)carbamoyl]piperidin-1-yl]azepane-1-carboxylate
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 93 C-terminal residues, 200 N-terminal residues, 68 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 6zg4 chain A to query has RMSD 1.04 using 56 of 129 paired
+residues within cutoff distance 2.0
+jwu title:
+T4 Lysozyme L99A/M102Q with 1,2-Dihydro-1,2-azaborine Bound [more info...]
+Chain information for 5jwu #165
+---
+Chain | Description | UniProt
+A | Endolysin | ENLYS_BPT4 1-164
+Non-standard residues in 5jwu #165
+---
+B20 — 1,2-dihydro-1,2-azaborinine (1,2-dihydro-1,2-azaborine)
+CL — chloride ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 8 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 5jwu chain A to query has RMSD 0.952 using 44 of 127 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 4pjz from http://files.rcsb.org/download/4pjz.cif
+Fetching CCD 3FG from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/G/3FG/3FG.cif
+Fetching CCD 3MY from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/Y/3MY/3MY.cif
+Fetching CCD AIB from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/B/AIB/AIB.cif
+Fetching CCD DAL from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/L/DAL/DAL.cif
+Fetching CCD GCS from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/S/GCS/GCS.cif
+Fetching CCD GHP from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/GHP/GHP.cif
+Fetching CCD MAN from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/N/MAN/MAN.cif
+Fetching CCD OMY from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/Y/OMY/OMY.cif
+Fetching CCD T55 from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/5/T55/T55.cif
+pjz title:
+Crystal structure of T4 lysozyme-GSS-peptide In complex with teicoplanin-A2-2
+[more info...]
+Chain information for 4pjz #166
+---
+Chain | Description | UniProt
+A | Lysozyme | D9IEF7_BPT4 1-164
+B | TEICOPLANIN-A2-2 |
+Non-standard residues in 4pjz #166
+---
+FG — (2S)-amino(3,5-dihydroxyphenyl)ethanoic acid
+GCS — 2-amino-2-deoxy-beta-D-glucopyranose (beta-D-glucosamine;
+-amino-2-deoxy-beta-D-glucose; 2-amino-2-deoxy-D-glucose; 2-amino-2-deoxy-
+glucose; D-GLUCOSAMINE)
+GOL — glycerol (glycerin; propane-1,2,3-triol)
+MAN — alpha-D-mannopyranose (alpha-D-mannose; D-mannose; mannose)
+NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine;
+-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose;
+-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE)
+PO4 — phosphate ion
+T55 — 8-methylnonanoic acid
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 1 extra chains, 13 C-terminal residues, 2 N-terminal residues, 51 non-
+polymer residues more than 3.0 Angstroms away.
+Alignment of 4pjz chain A to query has RMSD 0.889 using 45 of 124 paired
+residues within cutoff distance 2.0
+exm title:
+The crystal structure of an engineered phage lysin containing the binding
+domain of pesticin and the killing domain of T4-lysozyme [more info...]
+Chain information for 4exm #167
+---
+Chain | Description | UniProt
+A B C D | Pesticin, Lysozyme Chimera | Q57159_YERPE 6-172, LYS_BPT4 173-334
+exm mmCIF Assemblies
+---
+| author_and_software_defined_assembly
+| author_and_software_defined_assembly
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 3 extra chains, 10 C-terminal residues, 167 N-terminal residues, 70
+non-polymer residues more than 3.0 Angstroms away.
+Alignment of 4exm chain C to query has RMSD 1.11 using 52 of 127 paired
+residues within cutoff distance 2.0
+l title:
+Generating ligand binding sites In T4 lysozyme using deficiency-creating
+substitutions [more info...]
+Chain information for 227l #168
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 227l #168
+---
+BME — β-mercaptoethanol
+BNZ — benzene
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 227l chain A to query has RMSD 1.03 using 49 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1l89 from http://files.rcsb.org/download/1l89.cif
+l89 title:
+Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
+lysozyme have different structural and thermodynamic consequences [more
+info...]
+Chain information for 1l89 #169
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l89 #169
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l89 chain A to query has RMSD 1.07 using 51 of 125 paired
+residues within cutoff distance 2.0
+dyf title:
+Determination of α-helix propensity within the context of A folded protein:
+sites 44 and 131 In bacteriophage T4 lysozyme [more info...]
+Chain information for 1dyf #170
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1dyf #170
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1dyf chain A to query has RMSD 0.976 using 47 of 127 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 166l from http://files.rcsb.org/download/166l.cif
+l title:
+Control of enzyme activity by an engineered disulfide bond [more info...]
+Chain information for 166l #171
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 166l #171
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 166l chain A to query has RMSD 1.03 using 49 of 125 paired
+residues within cutoff distance 2.0
+w58 title:
+T4 Lysozyme L99A with n-Pentylbenzene Bound [more info...]
+Chain information for 4w58 #172
+---
+Chain | Description | UniProt
+A | Endolysin | ENLYS_BPT4 1-164
+Non-standard residues in 4w58 #172
+---
+H2 — pentylbenzene
+EPE — 4-(2-hydroxyethyl)-1-piperazine ethanesulfonic acid (HEPES)
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 12 C-terminal residues, 2 N-terminal residues, 39 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 4w58 chain A to query has RMSD 0.996 using 46 of 124 paired
+residues within cutoff distance 2.0
+c7z title:
+T4 lysozyme mutant D89A/R96H at room temperature [more info...]
+Chain information for 3c7z #173
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3c7z #173
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 26 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3c7z chain A to query has RMSD 0.984 using 48 of 127 paired
+residues within cutoff distance 2.0
+qt7 title:
+E11N Mutant of T4 Lysozyme [more info...]
+Chain information for 1qt7 #174
+---
+Chain | Description | UniProt
+A | PROTEIN (T4 LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 1qt7 #174
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 11 C-terminal residues, 2 N-terminal residues, 86 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1qt7 chain A to query has RMSD 1 using 48 of 125 paired residues
+within cutoff distance 2.0
+l title:
+Thermodynamic and structural compensation In "size-switch" core-repacking
+variants of T4 lysozyme [more info...]
+Chain information for 196l #175
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 196l #175
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 196l chain A to query has RMSD 1.03 using 49 of 124 paired
+residues within cutoff distance 2.0
+l title:
+Enhancement of protein stability by the combination of point mutations In T4
+lysozyme is additive [more info...]
+Chain information for 189l #176
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 24 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 189l chain A to query has RMSD 1.26 using 57 of 127 paired
+residues within cutoff distance 2.0
+z36 title:
+Crystal structure of the KAP1 tripartite motif in complex with the ZNF93 KRAB
+domain [more info...]
+Chain information for 7z36 #177
+---
+Chain | Description | UniProt
+A B | Endolysin,Transcription intermediary factor 1-beta,Isoform 2 of Transcription intermediary factor 1-beta | ENLYS_BPT4 26-185, TIF1B_HUMAN 187-271, TIF1B-2_HUMAN 272-482
+C S | SMARCAD1 CUE1 domain |
+D | Zinc finger protein 93 | ZNF93_HUMAN 2-71
+Non-standard residues in 7z36 #177
+---
+ZN — zinc ion
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 4 extra chains, 284 C-terminal residues, 1 N-terminal residues, 8 non-
+polymer residues more than 3.0 Angstroms away.
+Alignment of 7z36 chain B to query has RMSD 1.13 using 54 of 135 paired
+residues within cutoff distance 2.0
+lx9 title:
+T4 lysozyme mutant L99A [more info...]
+Chain information for 7lx9 #178
+---
+Chain | Description | UniProt
+A | Lysozyme | D9IEF7_BPT4 1-164
+Non-standard residues in 7lx9 #178
+---
+TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer)
+YGM — (but-3-en-1-yl)benzene
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 9 C-terminal residues, 2 N-terminal residues, 31 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 7lx9 chain A to query has RMSD 0.917 using 44 of 123 paired
+residues within cutoff distance 2.0
+lwo title:
+Structure of Spin-labelled T4 lysozyme mutant L115C-R119C-R1 at 100K [more
+info...]
+Chain information for 5lwo #179
+---
+Chain | Description | UniProt
+A | Endolysin | ENLYS_BPT4 1-164
+Non-standard residues in 5lwo #179
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+K — potassium ion
+PO4 — phosphate ion
+RXR —
+[2,2,5,5-tetramethyl-3,4-bis(sulfanylmethyl)-2,5-dihydro-1H-pyrrol-1-yl]oxidanyl
+radical (3,4-bis(thiomethyl)-2,2,5,5-tetramethyl-1H-Pyrrol-1-yloxyl radical)
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 5lwo chain A to query has RMSD 0.973 using 49 of 124 paired
+residues within cutoff distance 2.0
+phu title:
+Crystal structure of Human GPR40 bound to allosteric agonist TAK-875 [more
+info...]
+Chain information for 4phu #180
+---
+Chain | Description | UniProt
+A | Free fatty acid receptor 1,Lysozyme | FFAR1_HUMAN 1-211 2214-2300, LYS_BPT4 1002-1161
+Non-standard residues in 4phu #180
+---
+PE — pentaethylene glycol (PEG400)
+YB —
+[(3S)-6-({2',6'-dimethyl-4'-[3-(methylsulfonyl)propoxy]biphenyl-3-yl}methoxy)-2,3-dihydro-1-benzofuran-3-yl]acetic
+acid
+DMS — dimethyl sulfoxide
+OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 77 C-terminal residues, 206 N-terminal residues, 77 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 4phu chain A to query has RMSD 0.953 using 47 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 3qak from http://files.rcsb.org/download/3qak.cif
+qak title:
+Agonist bound structure of the human adenosine A2a receptor [more info...]
+Chain information for 3qak #181
+---
+Chain | Description | UniProt
+A | Adenosine receptor A2a,lysozyme chimera | AA2AR_HUMAN 2-208 222-316, LYS_BPT4 1002-1161
+Non-standard residues in 3qak #181
+---
+OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
+UKA —
+-(2,2-diphenylethylamino)-9-[(2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxy-
+oxolan-2-yl]-N-[2-[(1-pyridin-2-ylpiperidin-4-yl)carbamoylamino]ethyl]purine-2-carboxamide
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 95 C-terminal residues, 198 N-terminal residues, 7 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 3qak chain A to query has RMSD 1.17 using 62 of 125 paired
+residues within cutoff distance 2.0
+cdq title:
+Contributions of all 20 amino acids at site 96 to the stability and structure
+of T4 lysozyme [more info...]
+Chain information for 3cdq #182
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3cdq #182
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+K — potassium ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 32 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3cdq chain A to query has RMSD 0.991 using 48 of 125 paired
+residues within cutoff distance 2.0
+pqj title:
+T4 lysozyme core repacking mutant A111V/CORE10/Ta [more info...]
+Chain information for 1pqj #183
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 1pqj #183
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+K — potassium ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1pqj chain A to query has RMSD 0.926 using 44 of 124 paired
+residues within cutoff distance 2.0
+lpy title:
+Multiple Methionine Substitutions in T4 Lysozyme [more info...]
+Chain information for 1lpy #184
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1lpy #184
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+PO4 — phosphate ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 9 C-terminal residues, 2 N-terminal residues, 45 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1lpy chain A to query has RMSD 1.11 using 50 of 126 paired
+residues within cutoff distance 2.0
+l70 title:
+Multiple stabilizing alanine replacements within α-helix 126-134 of T4
+lysozyme have independent, additive effects on both structure and stability
+[more info...]
+Chain information for 1l70 #185
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1l70 #185
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l70 chain A to query has RMSD 0.942 using 45 of 125 paired
+residues within cutoff distance 2.0
+l52 title:
+Structural and thermodynamic analysis of the packing of two α-helices In
+bacteriophage T4 lysozyme [more info...]
+Chain information for 1l52 #186
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l52 chain A to query has RMSD 0.99 using 47 of 125 paired
+residues within cutoff distance 2.0
+l43 title:
+Cumulative site-directed charge-change replacements In bacteriophage T4
+lysozyme suggest that long-range electrostatic interactions contribute little
+to protein stability [more info...]
+Chain information for 1l43 #187
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l43 chain A to query has RMSD 0.999 using 48 of 126 paired
+residues within cutoff distance 2.0
+l22 title:
+Contributions of left-handed helical residues to the structure and stability
+of bacteriophage T4 lysozyme [more info...]
+Chain information for 1l22 #188
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l22 chain A to query has RMSD 1.02 using 48 of 125 paired
+residues within cutoff distance 2.0
+l05 title:
+Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
+phage T4 lysozyme [more info...]
+Chain information for 1l05 #189
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l05 chain A to query has RMSD 0.996 using 48 of 125 paired
+residues within cutoff distance 2.0
+cu2 title:
+T4 lysozyme mutant L84M [more info...]
+Chain information for 1cu2 #190
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1cu2 #190
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1cu2 chain A to query has RMSD 0.911 using 46 of 125 paired
+residues within cutoff distance 2.0
+iih title:
+crystal structure of mitochondrial calcium uptake 2(MICU2) [more info...]
+Chain information for 6iih #191
+---
+Chain | Description | UniProt
+A B | Endolysin,Calcium uptake protein 2, mitochondrial | ENLYS_BPT4 1-161, MICU2_HUMAN 164-485
+Non-standard residues in 6iih #191
+---
+CA — calcium ion
+Deleted 1 extra chains, 284 C-terminal residues, 2 N-terminal residues, 764
+non-polymer residues more than 3.0 Angstroms away.
+Alignment of 6iih chain B to query has RMSD 0.929 using 46 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 5cgc from http://files.rcsb.org/download/5cgc.cif
+Fetching CCD 51D from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/D/51D/51D.cif
+Fetching CCD MES from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/S/MES/MES.cif
+cgc title:
+Structure of the human class C GPCR metabotropic glutamate receptor 5
+transmembrane domain in complex with the negative allosteric modulator
+-chloro-4-fluoro-5-[6-(1H-pyrazol-1-yl)pyrimidin-4-yl]benzonitrile [more
+info...]
+Chain information for 5cgc #192
+---
+Chain | Description | UniProt
+A | Metabotropic glutamate receptor 5,Endolysin,Metabotropic glutamate receptor 5 | GRM5_HUMAN 569-678 679-836, ENLYS_BPT4 1002-1161
+Non-standard residues in 5cgc #192
+---
+D — 3-chloro-4-fluoro-5-[6-(1H-pyrazol-1-yl)pyrimidin-4-yl]benzonitrile
+MES — 2-(N-morpholino)-ethanesulfonic acid
+OLA — oleic acid
+Deleted 146 C-terminal residues, 112 N-terminal residues, 44 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 5cgc chain A to query has RMSD 1.15 using 66 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 4tn3 from http://files.rcsb.org/download/4tn3.cif
+tn3 title:
+Structure of the BBox-Coiled-coil region of Rhesus Trim5alpha [more info...]
+Chain information for 4tn3 #193
+---
+Chain | Description | UniProt
+A B | TRIM5/cyclophilin A fusion protein/T4 Lysozyme chimera | G9MAP5_MACMU 88-303, ENLYS_BPT4 304-467
+Non-standard residues in 4tn3 #193
+---
+ZN — zinc ion
+Deleted 1 extra chains, 11 C-terminal residues, 159 N-terminal residues, 4
+non-polymer residues more than 3.0 Angstroms away.
+Alignment of 4tn3 chain A to query has RMSD 1.03 using 48 of 160 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 3rze from http://files.rcsb.org/download/3rze.cif
+Fetching CCD 5EH from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/H/5EH/5EH.cif
+Fetching CCD D7V from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/V/D7V/D7V.cif
+rze title:
+Structure of the human histamine H1 receptor in complex with doxepin [more
+info...]
+Chain information for 3rze #194
+---
+Chain | Description | UniProt
+A | Histamine H1 receptor, Lysozyme chimera | HRH1_HUMAN 20-221 405-487, LYS_BPT4 1002-1161
+Non-standard residues in 3rze #194
+---
+EH — (3E)-3-(dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-dimethylpropan-1-amine
+D7V — (3Z)-3-(dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-dimethylpropan-1-amine
+OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
+PO4 — phosphate ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 89 C-terminal residues, 188 N-terminal residues, 4 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 3rze chain A to query has RMSD 1.09 using 56 of 126 paired
+residues within cutoff distance 2.0
+lzm title:
+Structural studies of mutants of T4 lysozyme that alter hydrophobic
+stabilization [more info...]
+Chain information for 3lzm #195
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3lzm chain A to query has RMSD 1.05 using 50 of 125 paired
+residues within cutoff distance 2.0
+c7w title:
+Contributions of all 20 amino acids at site 96 to the stability and structure
+of T4 lysozyme [more info...]
+Chain information for 3c7w #196
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3c7w #196
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 36 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3c7w chain A to query has RMSD 0.989 using 48 of 124 paired
+residues within cutoff distance 2.0
+p3n title:
+Core redesign back-revertant I103V/CORE10 [more info...]
+Chain information for 1p3n #197
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1p3n #197
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+K — potassium ion
+PO4 — phosphate ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 99 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1p3n chain A to query has RMSD 0.991 using 48 of 127 paired
+residues within cutoff distance 2.0
+l83 title:
+A cavity-containing mutant of T4 lysozyme is stabilized by buried benzene
+[more info...]
+Chain information for 1l83 #198
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l83 #198
+---
+BME — β-mercaptoethanol
+BNZ — benzene
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l83 chain A to query has RMSD 0.952 using 47 of 127 paired
+residues within cutoff distance 2.0
+l47 title:
+Cumulative site-directed charge-change replacements In bacteriophage T4
+lysozyme suggest that long-range electrostatic interactions contribute little
+to protein stability [more info...]
+Chain information for 1l47 #199
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 10 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l47 chain A to query has RMSD 1 using 49 of 126 paired residues
+within cutoff distance 2.0
+l17 title:
+Hydrophobic stabilization In T4 lysozyme determined directly by multiple
+substitutions of ile 3 [more info...]
+Chain information for 1l17 #200
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l17 chain A to query has RMSD 0.985 using 48 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1l16 from http://files.rcsb.org/download/1l16.cif
+l16 title:
+Structural analysis of the temperature-sensitive mutant of bacteriophage T4
+lysozyme, glycine 156 (right arrow) aspartic acid [more info...]
+Chain information for 1l16 #201
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l16 chain A to query has RMSD 1.04 using 50 of 125 paired
+residues within cutoff distance 2.0
+l13 title:
+Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
+phage T4 lysozyme [more info...]
+Chain information for 1l13 #202
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 54 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l13 chain A to query has RMSD 1.03 using 49 of 125 paired
+residues within cutoff distance 2.0
+l11 title:
+Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
+phage T4 lysozyme [more info...]
+Chain information for 1l11 #203
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1l11 #203
+---
+BME — β-mercaptoethanol
+Deleted 11 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l11 chain A to query has RMSD 1.02 using 48 of 125 paired
+residues within cutoff distance 2.0
+l06 title:
+Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
+phage T4 lysozyme [more info...]
+Chain information for 1l06 #204
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l06 chain A to query has RMSD 1.03 using 49 of 124 paired
+residues within cutoff distance 2.0
+ky0 title:
+Methionine core mutant of T4 lysozyme [more info...]
+Chain information for 1ky0 #205
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-162
+Non-standard residues in 1ky0 #205
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1ky0 chain A to query has RMSD 1.01 using 51 of 126 paired
+residues within cutoff distance 2.0
+c6a title:
+T4 lysozyme mutant C54T/C97A/L133A In the presence of 8 atm krypton [more
+info...]
+Chain information for 1c6a #206
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 1c6a #206
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+KR — krypton
+Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1c6a chain A to query has RMSD 1.05 using 49 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Control of enzyme activity by an engineered disulfide bond [more info...]
+Chain information for 158l #207
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 158l #207
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 158l chain A to query has RMSD 1.03 using 49 of 125 paired
+residues within cutoff distance 2.0
+l title:
+The energetic cost and the structural consequences of burying A hydroxyl group
+within the core of A protein determined from ala to ser and val to THR
+substitutions In T4 lysozyme [more info...]
+Chain information for 126l #208
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 126l #208
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 126l chain A to query has RMSD 1.03 using 49 of 125 paired
+residues within cutoff distance 2.0
+l title:
+The energetic cost and the structural consequences of burying A hydroxyl group
+within the core of A protein determined from ala to ser and val to THR
+substitutions In T4 lysozyme [more info...]
+Chain information for 120l #209
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 120l #209
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 84 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 120l chain A to query has RMSD 1.03 using 50 of 125 paired
+residues within cutoff distance 2.0
+l title:
+The energetic cost and the structural consequences of burying A hydroxyl group
+within the core of A protein determined from ala to ser and val to THR
+substitutions In T4 lysozyme [more info...]
+Chain information for 118l #210
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 118l #210
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 118l chain A to query has RMSD 0.996 using 48 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 8jwz from http://files.rcsb.org/download/8jwz.cif
+Fetching CCD U30 from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/0/U30/U30.cif
+jwz title:
+Crystal structure of A2AR-T4L in complex with AB928 [more info...]
+Chain information for 8jwz #211
+---
+Chain | Description | UniProt
+A | Adenosine receptor A2a,Endolysin | AA2AR_HUMAN 2-208 369-463, D9IEF7_BPT4 209-368
+Non-standard residues in 8jwz #211
+---
+CLR — cholesterol
+NA — sodium ion
+OLA — oleic acid
+OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
+PEG — di(hydroxyethyl)ether
+U30 —
+-[2-azanyl-6-[1-[[6-(2-oxidanylpropan-2-yl)pyridin-2-yl]methyl]-1,2,3-triazol-4-yl]pyrimidin-4-yl]-2-methyl-
+benzenecarbonitrile
+Deleted 97 C-terminal residues, 202 N-terminal residues, 254 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 8jwz chain A to query has RMSD 1.09 using 58 of 126 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 5dgy from http://files.rcsb.org/download/5dgy.cif
+dgy title:
+Crystal structure of rhodopsin bound to visual arrestin [more info...]
+Chain information for 5dgy #212
+---
+Chain | Description | UniProt
+A B C D | Endolysin,Rhodopsin,S-arrestin | ENLYS_BPT4 -159-0, OPSD_HUMAN 1-994, ARRS_MOUSE 1010-1392
+dgy mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 3 extra chains, 681 C-terminal residues, 1 N-terminal residues.
+Alignment of 5dgy chain A to query has RMSD 1.23 using 61 of 125 paired
+residues within cutoff distance 2.0
+hwl title:
+Crystal Structure of T4 lysozyme with the unnatural amino acid p-Acetyl-L-
+Phenylalanine incorporated at position 131 [more info...]
+Chain information for 3hwl #213
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3hwl #213
+---
+AZI — azide ion
+CL — chloride ion
+hwl mmCIF Assemblies
+---
+| software_defined_assembly
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Hit structure sequence 3hwl_A amino acid F at sequence position 130 does not
+match sequence alignment N at position 128. Structure sequence
+MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAFNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL.
+Alignment sequence
+IFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAANLAKSRWYNQTPNRAKRVITTF.
+Deleted 10 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3hwl chain A to query has RMSD 0.82 using 37 of 125 paired
+residues within cutoff distance 2.0
+l title:
+The response of T4 lysozyme to large-to-small substitutions within the core
+and its relation to the hydrophobic effect [more info...]
+Chain information for 239l #214
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 239l #214
+---
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 239l chain A to query has RMSD 0.956 using 47 of 126 paired
+residues within cutoff distance 2.0
+l title:
+Generating ligand binding sites In T4 lysozyme using deficiency-creating
+substitutions [more info...]
+Chain information for 229l #215
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 229l #215
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+GAI — guanidine
+Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 229l chain A to query has RMSD 1.03 using 51 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Protein structure plasticity exemplified by insertion and deletion mutants In
+T4 lysozyme [more info...]
+Chain information for 211l #216
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 211l #216
+---
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 211l chain A to query has RMSD 0.989 using 47 of 125 paired
+residues within cutoff distance 2.0
+qtb title:
+The introduction of strain and its effects on the structure and stability of
+T4 lysozyme [more info...]
+Chain information for 1qtb #217
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-162
+Non-standard residues in 1qtb #217
+---
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1qtb chain A to query has RMSD 1.02 using 49 of 126 paired
+residues within cutoff distance 2.0
+pqo title:
+T4 Lysozyme Core Repacking Mutant L118I/TA [more info...]
+Chain information for 1pqo #218
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 1pqo #218
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+K — potassium ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1pqo chain A to query has RMSD 0.949 using 48 of 127 paired
+residues within cutoff distance 2.0
+l44 title:
+Cumulative site-directed charge-change replacements In bacteriophage T4
+lysozyme suggest that long-range electrostatic interactions contribute little
+to protein stability [more info...]
+Chain information for 1l44 #219
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l44 chain A to query has RMSD 0.943 using 46 of 125 paired
+residues within cutoff distance 2.0
+l28 title:
+Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
+protein stability [more info...]
+Chain information for 1l28 #220
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l28 chain A to query has RMSD 1.06 using 50 of 127 paired
+residues within cutoff distance 2.0
+l02 title:
+Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
+phage T4 lysozyme [more info...]
+Chain information for 1l02 #221
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l02 chain A to query has RMSD 1.04 using 50 of 127 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1l00 from http://files.rcsb.org/download/1l00.cif
+l00 title:
+Perturbation of TRP 138 In T4 lysozyme by mutations At GLN 105 used to
+correlate changes In structure, stability, solvation, and spectroscopic
+properties [more info...]
+Chain information for 1l00 #222
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1l00 #222
+---
+BME — β-mercaptoethanol
+Deleted 9 C-terminal residues, 2 N-terminal residues, 78 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l00 chain A to query has RMSD 0.995 using 46 of 127 paired
+residues within cutoff distance 2.0
+g07 title:
+Crystal structure of T4 lysozyme mutant V149C [more info...]
+Chain information for 1g07 #223
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 1g07 #223
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 9 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1g07 chain A to query has RMSD 1.01 using 49 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Thermodynamic and structural compensation In "size-switch" core-repacking
+variants of T4 lysozyme [more info...]
+Chain information for 199l #224
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 199l #224
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 199l chain A to query has RMSD 1.03 using 51 of 124 paired
+residues within cutoff distance 2.0
+l title:
+Thermodynamic and structural compensation In "size-switch" core-repacking
+variants of T4 lysozyme [more info...]
+Chain information for 195l #225
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 195l #225
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 195l chain A to query has RMSD 0.95 using 48 of 127 paired
+residues within cutoff distance 2.0
+p41 title:
+Crystal Structure of human mARC1 A165T Variant [more info...]
+Chain information for 7p41 #226
+---
+Chain | Description | UniProt
+D | Mitochondrial amidoxime-reducing component 1,Endolysin,Mitochondrial amidoxime-reducing component 1 | MARC1_HUMAN 53-128 288-495, D9IEF7_BPT4 129-287
+Non-standard residues in 7p41 #226
+---
+B3P — 2-[3-(2-hydroxy-1,1-dihydroxymethyl-
+ethylamino)-propylamino]-2-hydroxymethyl-propane-1,3-diol
+CL — chloride ion
+EFK — oxidanyl(oxidanylidene)molybdenum
+MTE — phosphonic
+acidmono-(2-amino-5,6-dimercapto-4-oxo-3,7,8A,9,10,10A-hexahydro-4H-8-oxa-1,3,9,10-tetraaza-
+anthracen-7-ylmethyl)ester
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 214 C-terminal residues, 79 N-terminal residues, 402 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 7p41 chain D to query has RMSD 0.947 using 48 of 125 paired
+residues within cutoff distance 2.0
+lxa title:
+T4 lysozyme mutant L99A [more info...]
+Chain information for 7lxa #227
+---
+Chain | Description | UniProt
+A | Lysozyme | D9IEF7_BPT4 1-164
+Non-standard residues in 7lxa #227
+---
+BME — β-mercaptoethanol
+TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer)
+YGS — (2-methylprop-2-en-1-yl)benzene
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 9 C-terminal residues, 1 N-terminal residues, 34 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 7lxa chain A to query has RMSD 0.922 using 44 of 122 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 6luq from http://files.rcsb.org/download/6luq.cif
+Fetching CCD GMJ from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/J/GMJ/GMJ.cif
+luq title:
+Haloperidol bound D2 dopamine receptor structure inspired discovery of subtype
+selective ligands [more info...]
+Chain information for 6luq #228
+---
+Chain | Description | UniProt
+A | chimera of D(2) dopamine receptor and Endolysin | DRD2_HUMAN 35-222 388-464, D9IEF7_BPT4
+Non-standard residues in 6luq #228
+---
+GMJ —
+-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one
+OLA — oleic acid
+Deleted 85 C-terminal residues, 184 N-terminal residues, 12 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 6luq chain A to query has RMSD 1.03 using 54 of 126 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 3sb5 from http://files.rcsb.org/download/3sb5.cif
+sb5 title:
+Zn-mediated Trimer of T4 Lysozyme R125C/E128C by Synthetic Symmetrization
+[more info...]
+Chain information for 3sb5 #229
+---
+Chain | Description | UniProt
+A B C D | Lysozyme | LYS_BPT4 1-162
+Non-standard residues in 3sb5 #229
+---
+CL — chloride ion
+GOL — glycerol (glycerin; propane-1,2,3-triol)
+MG — magnesium ion
+ZN — zinc ion
+sb5 mmCIF Assemblies
+---
+| author_and_software_defined_assembly
+| author_and_software_defined_assembly
+| author_and_software_defined_assembly
+| author_and_software_defined_assembly
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 3 extra chains, 9 C-terminal residues, 4 N-terminal residues, 191 non-
+polymer residues more than 3.0 Angstroms away.
+Alignment of 3sb5 chain A to query has RMSD 1.17 using 68 of 125 paired
+residues within cutoff distance 2.0
+jr6 title:
+Sequential reorganization of beta-sheet topology by insertion of a single
+strand [more info...]
+Chain information for 3jr6 #230
+---
+Chain | Description | UniProt
+A B C D | Lysozyme | LYS_BPT4 1-170
+Non-standard residues in 3jr6 #230
+---
+SO4 — sulfate ion
+jr6 mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+| author_defined_assembly
+| author_defined_assembly
+Deleted 3 extra chains, 10 C-terminal residues, 2 N-terminal residues, 6 non-
+polymer residues more than 3.0 Angstroms away.
+Alignment of 3jr6 chain B to query has RMSD 1.16 using 60 of 123 paired
+residues within cutoff distance 2.0
+cdr title:
+R96Q Mutant of wildtype phage T4 lysozyme at 298 K [more info...]
+Chain information for 3cdr #231
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3cdr #231
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 40 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3cdr chain A to query has RMSD 0.992 using 48 of 125 paired
+residues within cutoff distance 2.0
+c8q title:
+Contribution of all 20 amino acids at site 96 to the stability and structure
+of T4 lysozyme [more info...]
+Chain information for 3c8q #232
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3c8q #232
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+K — potassium ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 29 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3c8q chain A to query has RMSD 0.954 using 47 of 125 paired
+residues within cutoff distance 2.0
+l title:
+T4 lysozyme mutant M120L [more info...]
+Chain information for 233l #233
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 233l #233
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 233l chain A to query has RMSD 0.947 using 46 of 125 paired
+residues within cutoff distance 2.0
+ov7 title:
+T4 Lysozyme Cavity Mutant L99A/M102Q Bound with 2-Allyl-6-Methyl-Phenol [more
+info...]
+Chain information for 1ov7 #234
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 1ov7 #234
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+LYL — 2-allyl-6-methyl-phenol
+Deleted 9 C-terminal residues, 2 N-terminal residues, 22 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1ov7 chain A to query has RMSD 0.956 using 46 of 125 paired
+residues within cutoff distance 2.0
+lyf title:
+Dissection of helix capping In T4 lysozyme by structural and thermodynamic
+analysis of six amino acid substitutions At THR 59 [more info...]
+Chain information for 1lyf #235
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1lyf #235
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 7 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1lyf chain A to query has RMSD 0.934 using 46 of 127 paired
+residues within cutoff distance 2.0
+l81 title:
+Design and structural analysis of alternative hydrophobic core packing
+arrangements In bacteriophage T4 lysozyme [more info...]
+Chain information for 1l81 #236
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l81 #236
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l81 chain A to query has RMSD 1.12 using 53 of 124 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1l54 from http://files.rcsb.org/download/1l54.cif
+l54 title:
+The structural and thermodynamic consequences of burying A charged residue
+within the hydrophobic core of T4 lysozyme [more info...]
+Chain information for 1l54 #237
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l54 chain A to query has RMSD 0.936 using 46 of 125 paired
+residues within cutoff distance 2.0
+l50 title:
+Structural and thermodynamic analysis of the packing of two α-helices In
+bacteriophage T4 lysozyme [more info...]
+Chain information for 1l50 #238
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l50 chain A to query has RMSD 1.03 using 48 of 127 paired
+residues within cutoff distance 2.0
+l23 title:
+Enhanced protein thermostability from site-directed mutations that decrease
+the entropy of unfolding [more info...]
+Chain information for 1l23 #239
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l23 chain A to query has RMSD 1.03 using 49 of 125 paired
+residues within cutoff distance 2.0
+l19 title:
+Enhanced protein thermostability from designed mutations that interact with
+α-helix dipoles [more info...]
+Chain information for 1l19 #240
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l19 chain A to query has RMSD 1.04 using 49 of 125 paired
+residues within cutoff distance 2.0
+jqu title:
+Are Carboxy Terminii of Helices Coded by the Local Sequence or by Tertiary
+Structure Contacts [more info...]
+Chain information for 1jqu #241
+---
+Chain | Description | UniProt
+A B C D | Lysozyme | LYS_BPT4 1-164
+jqu mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+| author_defined_assembly
+| author_defined_assembly
+Deleted 3 extra chains, 11 C-terminal residues, 2 N-terminal residues, 28 non-
+polymer residues more than 3.0 Angstroms away.
+Alignment of 1jqu chain D to query has RMSD 1.24 using 52 of 121 paired
+residues within cutoff distance 2.0
+d2y title:
+N-terminal domain core methionine mutation [more info...]
+Chain information for 1d2y #242
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1d2y #242
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1d2y chain A to query has RMSD 0.962 using 47 of 125 paired
+residues within cutoff distance 2.0
+cu6 title:
+T4 lysozyme mutant L91A [more info...]
+Chain information for 1cu6 #243
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1cu6 #243
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1cu6 chain A to query has RMSD 0.97 using 47 of 127 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1b6i from http://files.rcsb.org/download/1b6i.cif
+b6i title:
+T4 lysozyme mutant with cys 54 replaced by THR, cys 97 replaced by ala, THR 21
+replaced by cys and lys 124 replaced by cys (C54T,C97A,T21C,K124C) [more
+info...]
+Chain information for 1b6i #244
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 1b6i #244
+---
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 33 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1b6i chain A to query has RMSD 0.986 using 47 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Rapid crystallization of T4 lysozyme by intermolecular disulfide crosslinking
+[more info...]
+Chain information for 138l #245
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 138l #245
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 50 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 138l chain A to query has RMSD 0.981 using 48 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Structures of randomly generated mutants of T4 lysozyme show that protein
+stability can Be enhanced by relaxation of strain and by improved hydrogen
+bonding via bound solvent [more info...]
+Chain information for 130l #246
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 130l #246
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 87 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 130l chain A to query has RMSD 0.931 using 46 of 125 paired
+residues within cutoff distance 2.0
+Atom OE1 has no neighbors to form bonds with according to residue template for
+GLN /A:-3
+Atom NE2 has no neighbors to form bonds with according to residue template for
+GLN /A:-3
+xom title:
+DCN1 bound to 8 [more info...]
+Chain information for 6xom #247
+---
+Chain | Description | UniProt
+A | Lysozyme, DCN1-like protein 1 chimera | D9IEF7_BPT4 1-164, DCNL1_HUMAN 1062-1259
+Non-standard residues in 6xom #247
+---
+EDO — 1,2-ethanediol (ethylene glycol)
+H8V —
+(2R)-N-[(2S)-2-cyclohexyl-2-({N-propanoyl-3-[6-(propan-2-yl)-1,3-benzothiazol-2-yl]-L-alanyl}amino)ethyl]-2-methyl-4-(morpholin-4-yl)butanamide
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 201 C-terminal residues, 4 N-terminal residues, 207 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 6xom chain A to query has RMSD 0.983 using 52 of 126 paired
+residues within cutoff distance 2.0
+d5a title:
+In meso in situ serial X-ray crystallography structure of the Beta2-adrenergic
+receptor at 100 K [more info...]
+Chain information for 5d5a #248
+---
+Chain | Description | UniProt
+A | Beta-2 adrenergic receptor,Endolysin,Beta-2 adrenergic receptor | ADRB2_HUMAN 1-230 263-365, ENLYS_BPT4 1002-1161
+Non-standard residues in 5d5a #248
+---
+P — dodecaethylene glycol (polyethylene glycol PEG400)
+ACM — acetamide
+BGC — beta-D-glucopyranose (beta-D-glucose; D-glucose; glucose)
+BU1 — 1,4-butanediol
+CAU — (2S)-1-(9H-Carbazol-4-yloxy)-3-(isopropylamino)propan-2-ol
+((S)-Carazolol)
+CLR — cholesterol
+GLC — alpha-D-glucopyranose (alpha-D-glucose; D-glucose; glucose)
+PLM — palmitic acid
+SO4 — sulfate ion
+Deleted 88 C-terminal residues, 197 N-terminal residues, 35 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 5d5a chain A to query has RMSD 1.04 using 49 of 132 paired
+residues within cutoff distance 2.0
+lzm title:
+Comparison of the crystal structure of bacteriophage T4 lysozyme At low,
+medium, and high ionic strengths [more info...]
+Chain information for 4lzm #249
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 4lzm #249
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 4lzm chain A to query has RMSD 1.02 using 49 of 125 paired
+residues within cutoff distance 2.0
+htb title:
+-propylphenol in complex with T4 lysozyme L99A/M102Q [more info...]
+Chain information for 3htb #250
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3htb #250
+---
+BME — β-mercaptoethanol
+JZ4 — 2-propylphenol
+PO4 — phosphate ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 10 C-terminal residues, 2 N-terminal residues, 97 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3htb chain A to query has RMSD 0.981 using 47 of 123 paired
+residues within cutoff distance 2.0
+quh title:
+L99G/E108V mutant of T4 lysozyme [more info...]
+Chain information for 1quh #251
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162
+Non-standard residues in 1quh #251
+---
+CL — chloride ion
+HEZ — hexane-1,6-diol
+Deleted 9 C-terminal residues, 2 N-terminal residues, 46 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1quh chain A to query has RMSD 0.994 using 49 of 127 paired
+residues within cutoff distance 2.0
+qt5 title:
+D20E mutant structure of T4 lysozyme [more info...]
+Chain information for 1qt5 #252
+---
+Chain | Description | UniProt
+A | PROTEIN (T4 LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 1qt5 #252
+---
+HED — 2-hydroxyethyl disulfide
+Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1qt5 chain A to query has RMSD 1 using 48 of 125 paired residues
+within cutoff distance 2.0
+l64 title:
+Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A
+polyalanine α-helix containing ten consecutive alanines [more info...]
+Chain information for 1l64 #253
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l64 #253
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l64 chain A to query has RMSD 0.937 using 46 of 124 paired
+residues within cutoff distance 2.0
+l58 title:
+Analysis of the interaction between charged side chains and the α-helix dipole
+using designed thermostable mutants of phage T4 lysozyme [more info...]
+Chain information for 1l58 #254
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1l58 #254
+---
+BME — β-mercaptoethanol
+Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l58 chain A to query has RMSD 0.963 using 47 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1l34 from http://files.rcsb.org/download/1l34.cif
+l34 title:
+High-resolution structure of the temperature-sensitive mutant of phage
+lysozyme, arg 96 (right arrow) his [more info...]
+Chain information for 1l34 #255
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l34 chain A to query has RMSD 1.02 using 48 of 125 paired
+residues within cutoff distance 2.0
+kw7 title:
+Methionine core mutant of T4 lysozyme [more info...]
+Chain information for 1kw7 #256
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-162
+Non-standard residues in 1kw7 #256
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1kw7 chain A to query has RMSD 0.975 using 46 of 125 paired
+residues within cutoff distance 2.0
+cu5 title:
+T4 lysozyme mutant L91M [more info...]
+Chain information for 1cu5 #257
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1cu5 #257
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1cu5 chain A to query has RMSD 0.988 using 48 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 6igl from http://files.rcsb.org/download/6igl.cif
+Fetching CCD SIN from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/N/SIN/SIN.cif
+igl title:
+Crystal Structure of human ETB receptor in complex with IRL1620 [more info...]
+Chain information for 6igl #258
+---
+Chain | Description | UniProt
+A | Endothelin receptor type B,Endolysin,Endothelin receptor type B | EDNRB_HUMAN 66-303 311-407, A0A097J809_BPT4 1000-1159
+B | IRL1620 |
+Non-standard residues in 6igl #258
+---
+CIT — citric acid
+OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
+SIN — succinic acid
+SO4 — sulfate ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 1 extra chains, 100 C-terminal residues, 215 N-terminal residues, 31
+non-polymer residues more than 3.0 Angstroms away.
+Alignment of 6igl chain A to query has RMSD 1.03 using 54 of 126 paired
+residues within cutoff distance 2.0
+bg5 title:
+Structure of
+-(benzo[d][1,3]dioxol-5-ylmethyl)-1-(1-propylpiperidin-4-yl)-3-(3-(trifluoromethyl)phenyl)urea
+bound to DCN1 [more info...]
+Chain information for 6bg5 #259
+---
+Chain | Description | UniProt
+A | Endolysin, DCN1-like protein 1 chimera | ENLYS_BPT4 1-164, DCNL1_HUMAN 1062-1259
+Non-standard residues in 6bg5 #259
+---
+DQD —
+N-[(2H-1,3-benzodioxol-5-yl)methyl]-N-(1-propylpiperidin-4-yl)-N'-[3-(trifluoromethyl)phenyl]urea
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 200 C-terminal residues, 15 N-terminal residues, 480 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 6bg5 chain A to query has RMSD 1.26 using 67 of 121 paired
+residues within cutoff distance 2.0
+l title:
+The response of T4 lysozyme to large-to-small substitutions within the core
+and its relation to the hydrophobic effect [more info...]
+Chain information for 243l #260
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 243l #260
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 243l chain A to query has RMSD 0.981 using 47 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Generating ligand binding sites In T4 lysozyme using deficiency-creating
+substitutions [more info...]
+Chain information for 226l #261
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 226l #261
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 226l chain A to query has RMSD 0.942 using 45 of 126 paired
+residues within cutoff distance 2.0
+qsq title:
+Cavity creating mutation [more info...]
+Chain information for 1qsq #262
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1qsq #262
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1qsq chain A to query has RMSD 0.989 using 48 of 125 paired
+residues within cutoff distance 2.0
+p7s title:
+T4 lysozyme core repacking mutant V103I/Ta [more info...]
+Chain information for 1p7s #263
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 83 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1p7s chain A to query has RMSD 1.3 using 60 of 124 paired
+residues within cutoff distance 2.0
+l98 title:
+Perturbation of TRP 138 In T4 lysozyme by mutations At GLN 105 used to
+correlate changes In structure, stability, solvation, and spectroscopic
+properties [more info...]
+Chain information for 1l98 #264
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1l98 #264
+---
+BME — β-mercaptoethanol
+Deleted 11 C-terminal residues, 2 N-terminal residues, 88 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l98 chain A to query has RMSD 0.955 using 46 of 127 paired
+residues within cutoff distance 2.0
+l80 title:
+Design and structural analysis of alternative hydrophobic core packing
+arrangements In bacteriophage T4 lysozyme [more info...]
+Chain information for 1l80 #265
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l80 #265
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l80 chain A to query has RMSD 0.926 using 45 of 125 paired
+residues within cutoff distance 2.0
+l41 title:
+Contributions of engineered surface salt bridges to the stability of T4
+lysozyme determined by directed mutagenesis [more info...]
+Chain information for 1l41 #266
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l41 chain A to query has RMSD 0.965 using 47 of 125 paired
+residues within cutoff distance 2.0
+l30 title:
+Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
+protein stability [more info...]
+Chain information for 1l30 #267
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l30 chain A to query has RMSD 1.02 using 48 of 125 paired
+residues within cutoff distance 2.0
+g1v title:
+T4 lysozyme mutant C54T/C97A/I58T [more info...]
+Chain information for 1g1v #268
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1g1v #268
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1g1v chain A to query has RMSD 0.909 using 45 of 125 paired
+residues within cutoff distance 2.0
+l title:
+A helix initiation signal In T4 lysozyme identified by polyalanine mutagenesis
+[more info...]
+Chain information for 191l #269
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 191l #269
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 191l chain A to query has RMSD 1.05 using 49 of 127 paired
+residues within cutoff distance 2.0
+l title:
+A helix initiation signal In T4 lysozyme identified by polyalanine mutagenesis
+[more info...]
+Chain information for 190l #270
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 190l #270
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 190l chain A to query has RMSD 0.973 using 46 of 127 paired
+residues within cutoff distance 2.0
+huk title:
+Crystal structure of T4 Lysozyme V131C synthetic dimer [more info...]
+Chain information for 2huk #271
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 2huk #271
+---
+SO4 — sulfate ion
+huk mmCIF Assemblies
+---
+| author_defined_assembly
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 33 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 2huk chain A to query has RMSD 1.04 using 54 of 127 paired
+residues within cutoff distance 2.0
+l title:
+The response of T4 lysozyme to large-to-small substitutions within the core
+and its relation to the hydrophobic effect [more info...]
+Chain information for 236l #272
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 236l #272
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 236l chain A to query has RMSD 1.03 using 50 of 127 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1ovk from http://files.rcsb.org/download/1ovk.cif
+Fetching CCD NYL from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/L/NYL/NYL.cif
+ovk title:
+T4 Lysozyme Cavity Mutant L99A/M102Q Bound with N-Allyl-Aniline [more info...]
+Chain information for 1ovk #273
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 1ovk #273
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+NYL — N-allyl-aniline
+Deleted 9 C-terminal residues, 2 N-terminal residues, 25 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1ovk chain A to query has RMSD 0.99 using 48 of 124 paired
+residues within cutoff distance 2.0
+c6t title:
+T4 lysozyme mutant C54T/C97A In the presence of 8 atm xenon [more info...]
+Chain information for 1c6t #274
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164
+Non-standard residues in 1c6t #274
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+XE — XENON
+Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1c6t chain A to query has RMSD 0.981 using 49 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Control of enzyme activity by an engineered disulfide bond [more info...]
+Chain information for 160l #275
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 160l #275
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 160l chain A to query has RMSD 0.997 using 48 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Rapid crystallization of T4 lysozyme by intermolecular disulfide crosslinking
+[more info...]
+Chain information for 139l #276
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 139l #276
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+l mmCIF Assemblies
+---
+| author_defined_assembly
+| software_defined_assembly
+Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 139l chain A to query has RMSD 0.976 using 48 of 125 paired
+residues within cutoff distance 2.0
+l title:
+The energetic cost and the structural consequences of burying A hydroxyl group
+within the core of A protein determined from ala to ser and val to THR
+substitutions In T4 lysozyme [more info...]
+Chain information for 123l #277
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 123l #277
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 123l chain A to query has RMSD 0.999 using 48 of 125 paired
+residues within cutoff distance 2.0
+wf6 title:
+Agonist bound human A2a adenosine receptor with S91A mutation at 2.90 A
+resolution [more info...]
+Chain information for 5wf6 #278
+---
+Chain | Description | UniProt
+A | Human A2a adenosine receptor T4L chimera | AA2AR_HUMAN 2-208 222-316, ENLYS_BPT4 1002-1161
+Non-standard residues in 5wf6 #278
+---
+OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
+UKA —
+-(2,2-diphenylethylamino)-9-[(2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxy-
+oxolan-2-yl]-N-[2-[(1-pyridin-2-ylpiperidin-4-yl)carbamoylamino]ethyl]purine-2-carboxamide
+Deleted 94 C-terminal residues, 184 N-terminal residues, 4 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 5wf6 chain A to query has RMSD 1.15 using 62 of 136 paired
+residues within cutoff distance 2.0
+l title:
+The response of T4 lysozyme to large-to-small substitutions within the core
+and its relation to the hydrophobic effect [more info...]
+Chain information for 249l #279
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 249l #279
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 249l chain A to query has RMSD 0.968 using 47 of 125 paired
+residues within cutoff distance 2.0
+l title:
+The response of T4 lysozyme to large-to-small substitutions within the core
+and its relation to the hydrophobic effect [more info...]
+Chain information for 235l #280
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 235l #280
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 235l chain A to query has RMSD 1.01 using 48 of 125 paired
+residues within cutoff distance 2.0
+ssy title:
+Crystal structure of phage T4 lysozyme mutant G28A/I29A/G30A/C54T/C97A [more
+info...]
+Chain information for 1ssy #281
+---
+Chain | Description | UniProt
+A B | Lysozyme | LYS_BPT4 1-164
+ssy mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 57 non-
+polymer residues more than 3.0 Angstroms away.
+Alignment of 1ssy chain B to query has RMSD 0.901 using 45 of 125 paired
+residues within cutoff distance 2.0
+nhb title:
+Specificity of ligand binding in a buried non-polar cavity of t4 lysozyme:
+linkage of dynamics and structural plasticity [more info...]
+Chain information for 1nhb #282
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1nhb #282
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+PYJ — phenylethane
+Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1nhb chain A to query has RMSD 0.982 using 49 of 127 paired
+residues within cutoff distance 2.0
+l49 title:
+Structural and thermodynamic analysis of the packing of two α-helices In
+bacteriophage T4 lysozyme [more info...]
+Chain information for 1l49 #283
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l49 chain A to query has RMSD 1.1 using 49 of 125 paired
+residues within cutoff distance 2.0
+l33 title:
+Contributions of left-handed helical residues to the structure and stability
+of bacteriophage T4 lysozyme [more info...]
+Chain information for 1l33 #284
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l33 chain A to query has RMSD 1.03 using 49 of 125 paired
+residues within cutoff distance 2.0
+c64 title:
+T4 lysozyme mutant C54T/C97A/L121A In the presence of 8 atm krypton [more
+info...]
+Chain information for 1c64 #285
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164
+Non-standard residues in 1c64 #285
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+KR — krypton
+Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1c64 chain A to query has RMSD 1.03 using 50 of 126 paired
+residues within cutoff distance 2.0
+l title:
+The response of T4 lysozyme to large-to-small substitutions within the core
+and its relation to the hydrophobic effect [more info...]
+Chain information for 241l #286
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 241l #286
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 241l chain A to query has RMSD 0.932 using 46 of 125 paired
+residues within cutoff distance 2.0
+t97 title:
+Use of sequence duplication to engineer a ligand-triggered long-distance
+molecular switch in T4 Lysozyme [more info...]
+Chain information for 1t97 #287
+---
+Chain | Description | UniProt
+A B | Lysozyme | LYS_BPT4 1-175
+t97 mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 60 non-
+polymer residues more than 3.0 Angstroms away.
+Alignment of 1t97 chain A to query has RMSD 0.91 using 45 of 131 paired
+residues within cutoff distance 2.0
+cv4 title:
+T4 lysozyme mutant L118M [more info...]
+Chain information for 1cv4 #288
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1cv4 #288
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1cv4 chain A to query has RMSD 1.02 using 48 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Control of enzyme activity by an engineered disulfide bond [more info...]
+Chain information for 159l #289
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 159l #289
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 159l chain A to query has RMSD 0.945 using 47 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 6m9t from http://files.rcsb.org/download/6m9t.cif
+Fetching CCD J9P from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/J9P/J9P.cif
+m9t title:
+Crystal structure of EP3 receptor bound to misoprostol-FA [more info...]
+Chain information for 6m9t #290
+---
+Chain | Description | UniProt
+A | Prostaglandin E2 receptor EP3 subtype, Endolysin chimera | PE2R3_HUMAN 2-259 273-353, ENLYS_BPT4 1002-1161
+Non-standard residues in 6m9t #290
+---
+J9P —
+(11alpha,12alpha,13E,16S)-11,16-dihydroxy-16-methyl-9-oxoprost-13-en-1-oic
+acid
+OLA — oleic acid
+OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
+SO4 — sulfate ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 87 C-terminal residues, 204 N-terminal residues, 13 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 6m9t chain A to query has RMSD 1.38 using 75 of 128 paired
+residues within cutoff distance 2.0
+e97 title:
+T4 Lysozyme L99A/M102H with 2-Mercaptoethanol Bound [more info...]
+Chain information for 4e97 #291
+---
+Chain | Description | UniProt
+A B | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 4e97 #291
+---
+ACT — acetate ion
+BME — β-mercaptoethanol
+HED — 2-hydroxyethyl disulfide
+SO4 — sulfate ion
+e97 mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 1 extra chains, 11 C-terminal residues, 3 N-terminal residues, 288
+non-polymer residues more than 3.0 Angstroms away.
+Alignment of 4e97 chain B to query has RMSD 1.14 using 45 of 139 paired
+residues within cutoff distance 2.0
+l title:
+Lysozyme [more info...]
+Chain information for 253l #292
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 253l #292
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 11 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 253l chain A to query has RMSD 0.936 using 46 of 125 paired
+residues within cutoff distance 2.0
+l title:
+T4 lysozyme mutant M106L [more info...]
+Chain information for 234l #293
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 234l #293
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 234l chain A to query has RMSD 1.01 using 49 of 125 paired
+residues within cutoff distance 2.0
+qug title:
+E108V mutant of T4 lysozyme [more info...]
+Chain information for 1qug #294
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162
+Non-standard residues in 1qug #294
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 43 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1qug chain A to query has RMSD 0.945 using 47 of 127 paired
+residues within cutoff distance 2.0
+p64 title:
+T4 lysozyme core repacking mutant L133F/Ta [more info...]
+Chain information for 1p64 #295
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1p64 #295
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+K — potassium ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 84 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1p64 chain A to query has RMSD 1.02 using 48 of 125 paired
+residues within cutoff distance 2.0
+l56 title:
+Analysis of the interaction between charged side chains and the α-helix dipole
+using designed thermostable mutants of phage T4 lysozyme [more info...]
+Chain information for 1l56 #296
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1l56 #296
+---
+BME — β-mercaptoethanol
+Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l56 chain A to query has RMSD 0.937 using 45 of 127 paired
+residues within cutoff distance 2.0
+g0q title:
+Crystal structure of T4 lysozyme mutant V149I [more info...]
+Chain information for 1g0q #297
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 1g0q #297
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1g0q chain A to query has RMSD 1.02 using 49 of 127 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1dye from http://files.rcsb.org/download/1dye.cif
+dye title:
+Determination of α-helix propensity within the context of A folded protein:
+sites 44 and 131 In bacteriophage T4 lysozyme [more info...]
+Chain information for 1dye #298
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1dye #298
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1dye chain A to query has RMSD 1.05 using 49 of 127 paired
+residues within cutoff distance 2.0
+l title:
+Control of enzyme activity by an engineered disulfide bond [more info...]
+Chain information for 156l #299
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 156l #299
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 78 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 156l chain A to query has RMSD 0.973 using 47 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Structural basis of α-helix propensity At two sites In T4 lysozyme [more
+info...]
+Chain information for 109l #300
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 109l #300
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 109l chain A to query has RMSD 0.986 using 44 of 122 paired
+residues within cutoff distance 2.0
+i7j title:
+T4 Lysozyme L99A/M102H with benzene bound [more info...]
+Chain information for 4i7j #301
+---
+Chain | Description | UniProt
+A B | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 4i7j #301
+---
+ACT — acetate ion
+BME — β-mercaptoethanol
+BNZ — benzene
+HED — 2-hydroxyethyl disulfide
+SO4 — sulfate ion
+i7j mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 1 extra chains, 11 C-terminal residues, 13 N-terminal residues, 178
+non-polymer residues more than 3.0 Angstroms away.
+Alignment of 4i7j chain A to query has RMSD 1.2 using 47 of 126 paired
+residues within cutoff distance 2.0
+l title:
+AN adaptable metal-binding site engineered INTO T4 lysozyme [more info...]
+Chain information for 257l #302
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
+Non-standard residues in 257l #302
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 257l chain A to query has RMSD 1.03 using 49 of 125 paired
+residues within cutoff distance 2.0
+l title:
+The response of T4 lysozyme to large-to-small substitutions within the core
+and its relation to the hydrophobic effect [more info...]
+Chain information for 248l #303
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 248l #303
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 248l chain A to query has RMSD 0.908 using 45 of 125 paired
+residues within cutoff distance 2.0
+l title:
+The response of T4 lysozyme to large-to-small substitutions within the core
+and its relation to the hydrophobic effect [more info...]
+Chain information for 246l #304
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 246l #304
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 246l chain A to query has RMSD 0.973 using 48 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1l0k from http://files.rcsb.org/download/1l0k.cif
+l0k title:
+Methionine core mutant of T4 lysozyme [more info...]
+Chain information for 1l0k #305
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-162
+Non-standard residues in 1l0k #305
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 51 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l0k chain A to query has RMSD 0.938 using 41 of 122 paired
+residues within cutoff distance 2.0
+d3f title:
+N-terminal domain core methionine mutation [more info...]
+Chain information for 1d3f #306
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1d3f #306
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 51 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1d3f chain A to query has RMSD 0.99 using 48 of 125 paired
+residues within cutoff distance 2.0
+c60 title:
+T4 lysozyme mutant C54T/C97A/F153A In the presence of 8 atm argon [more
+info...]
+Chain information for 1c60 #307
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164
+Non-standard residues in 1c60 #307
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1c60 chain A to query has RMSD 1.02 using 49 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Control of enzyme activity by an engineered disulfide bond [more info...]
+Chain information for 165l #308
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 165l #308
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 165l chain A to query has RMSD 0.994 using 48 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 6d9m from http://files.rcsb.org/download/6d9m.cif
+Fetching CCD GMP from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/GMP/GMP.cif
+Fetching CCD GTP from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/GTP/GTP.cif
+Fetching CCD POP from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/POP/POP.cif
+d9m title:
+T4-Lysozyme fusion to Geobacter GGDEF [more info...]
+Chain information for 6d9m #309
+---
+Chain | Description | UniProt
+A | Fusion protein of Endolysin,Response receiver sensor diguanylate cyclase, GAF domain-containing | D9IEF7_BPT4 -162--2, Q39UD1_GEOMG 1-166
+Non-standard residues in 6d9m #309
+---
+ACT — acetate ion
+GMP — guanosine
+GOL — glycerol (glycerin; propane-1,2,3-triol)
+GTP — guanosine-5'-triphosphate
+MG — magnesium ion
+POP — pyrophosphate 2-
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 173 C-terminal residues, 2 N-terminal residues, 301 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 6d9m chain A to query has RMSD 1.3 using 57 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 5v83 from http://files.rcsb.org/download/5v83.cif
+Fetching CCD 8Z7 from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/7/8Z7/8Z7.cif
+v83 title:
+Structure of DCN1 bound to NAcM-HIT [more info...]
+Chain information for 5v83 #310
+---
+Chain | Description | UniProt
+A | Lysozyme,DCN1-like protein 1 chimera | D9IEF7_BPT4 1-164, DCNL1_HUMAN 1062-1259
+Non-standard residues in 5v83 #310
+---
+Z7 — N-(1-benzylpiperidin-4-yl)-N'-[3-(trifluoromethyl)phenyl]urea
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 199 C-terminal residues, 14 N-terminal residues, 198 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 5v83 chain A to query has RMSD 1.22 using 64 of 121 paired
+residues within cutoff distance 2.0
+jww title:
+T4 Lysozyme L99A/M102Q with 1-Hydro-2-ethyl-1,2-azaborine Bound [more info...]
+Chain information for 5jww #311
+---
+Chain | Description | UniProt
+A | Endolysin | ENLYS_BPT4 1-164
+Non-standard residues in 5jww #311
+---
+OQ — 2-ethyl-1,2-dihydro-1,2-azaborinine
+CL — chloride ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 8 C-terminal residues, 2 N-terminal residues, 162 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 5jww chain A to query has RMSD 0.963 using 43 of 122 paired
+residues within cutoff distance 2.0
+l25 title:
+Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
+protein stability [more info...]
+Chain information for 1l25 #312
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 82 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l25 chain A to query has RMSD 1.08 using 49 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Thermodynamic and structural compensation In "size-switch" core-repacking
+variants of T4 lysozyme [more info...]
+Chain information for 198l #313
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 198l #313
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 81 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 198l chain A to query has RMSD 0.988 using 50 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Conservation of solvent-binding sites In 10 crystal forms of T4 lysozyme [more
+info...]
+Chain information for 149l #314
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 15 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 149l chain A to query has RMSD 1.35 using 63 of 124 paired
+residues within cutoff distance 2.0
+x33 title:
+Leukotriene B4 receptor BLT1 in complex with BIIL260 [more info...]
+Chain information for 5x33 #315
+---
+Chain | Description | UniProt
+A | LTB4 receptor,Lysozyme,LTB4 receptor | Q9WTK1_CAVPO 15-213 214-348, A0A097J792_BPT4 1002-1161
+Non-standard residues in 5x33 #315
+---
+Y9 —
+-[[3-[[4-[2-(4-hydroxyphenyl)propan-2-yl]phenoxy]methyl]phenyl]methoxy]benzenecarboximidamide
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 83 C-terminal residues, 186 N-terminal residues, 1 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 5x33 chain A to query has RMSD 1.08 using 53 of 141 paired
+residues within cutoff distance 2.0
+l title:
+The energetic cost and the structural consequences of burying A hydroxyl group
+within the core of A protein determined from ala to ser and val to THR
+substitutions In T4 lysozyme [more info...]
+Chain information for 221l #316
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 221l #316
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 54 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 221l chain A to query has RMSD 1 using 49 of 125 paired residues
+within cutoff distance 2.0
+Fetching compressed mmCIF 1l68 from http://files.rcsb.org/download/1l68.cif
+l68 title:
+Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A
+polyalanine α-helix containing ten consecutive alanines [more info...]
+Chain information for 1l68 #317
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l68 #317
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l68 chain A to query has RMSD 0.936 using 47 of 125 paired
+residues within cutoff distance 2.0
+l27 title:
+Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
+protein stability [more info...]
+Chain information for 1l27 #318
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l27 chain A to query has RMSD 1 using 47 of 127 paired residues
+within cutoff distance 2.0
+g1w title:
+T4 lysozyme mutant C54T/C97A/Q105M [more info...]
+Chain information for 1g1w #319
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1g1w #319
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1g1w chain A to query has RMSD 1.03 using 49 of 127 paired
+residues within cutoff distance 2.0
+cup title:
+Methionine core mutant of T4 lysozyme [more info...]
+Chain information for 1cup #320
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1cup #320
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1cup chain A to query has RMSD 1.03 using 49 of 125 paired
+residues within cutoff distance 2.0
+iih title:
+crystal structure of mitochondrial calcium uptake 2(MICU2) [more info...]
+Chain information for 6iih #321
+---
+Chain | Description | UniProt
+A B | Endolysin,Calcium uptake protein 2, mitochondrial | ENLYS_BPT4 1-161, MICU2_HUMAN 164-485
+Non-standard residues in 6iih #321
+---
+CA — calcium ion
+Deleted 1 extra chains, 293 C-terminal residues, 2 N-terminal residues, 675
+non-polymer residues more than 3.0 Angstroms away.
+Alignment of 6iih chain A to query has RMSD 0.865 using 44 of 124 paired
+residues within cutoff distance 2.0
+l title:
+Protein structure plasticity exemplified by insertion and deletion mutants In
+T4 lysozyme [more info...]
+Chain information for 210l #322
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 210l #322
+---
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 210l chain A to query has RMSD 0.947 using 45 of 127 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 1l71 from http://files.rcsb.org/download/1l71.cif
+l71 title:
+Multiple stabilizing alanine replacements within α-helix 126-134 of T4
+lysozyme have independent, additive effects on both structure and stability
+[more info...]
+Chain information for 1l71 #323
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1l71 #323
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 7 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l71 chain A to query has RMSD 1.03 using 48 of 127 paired
+residues within cutoff distance 2.0
+cv0 title:
+T4 lysozyme mutant F104M [more info...]
+Chain information for 1cv0 #324
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1cv0 #324
+---
+CL — chloride ion
+HED — 2-hydroxyethyl disulfide
+Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1cv0 chain A to query has RMSD 1.02 using 49 of 125 paired
+residues within cutoff distance 2.0
+c67 title:
+T4 lysozyme mutant C54T/C97A/L121A/L133A In the presence of 8 atm krypton
+[more info...]
+Chain information for 1c67 #325
+---
+Chain | Description | UniProt
+A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164
+Non-standard residues in 1c67 #325
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+KR — krypton
+Deleted 9 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1c67 chain A to query has RMSD 1.09 using 50 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
+[more info...]
+Chain information for 175l #326
+---
+Chain | Description | UniProt
+A B | T4 LYSOZYME | LYS_BPT4 1-164
+l mmCIF Assemblies
+---
+| author_defined_assembly
+| author_defined_assembly
+Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 65 non-
+polymer residues more than 3.0 Angstroms away.
+Alignment of 175l chain A to query has RMSD 0.951 using 47 of 128 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 170l from http://files.rcsb.org/download/170l.cif
+l title:
+Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
+[more info...]
+Chain information for 170l #327
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 170l #327
+---
+BME — β-mercaptoethanol
+Deleted 11 C-terminal residues, 2 N-terminal residues, 6 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 170l chain A to query has RMSD 0.917 using 45 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Role of backbone flexibility In the accommodation of variants that repack the
+core of T4 lysozyme [more info...]
+Chain information for 142l #328
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 142l #328
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 48 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 142l chain A to query has RMSD 1.07 using 49 of 125 paired
+residues within cutoff distance 2.0
+Fetching compressed mmCIF 3vw7 from http://files.rcsb.org/download/3vw7.cif
+Fetching CCD VPX from
+https://files.wwpdb.org/pub/pdb/refdata/chem_comp/X/VPX/VPX.cif
+vw7 title:
+Crystal structure of human protease-activated receptor 1 (PAR1) bound with
+antagonist vorapaxar at 2.2 angstrom [more info...]
+Chain information for 3vw7 #329
+---
+Chain | Description | UniProt
+A | Proteinase-activated receptor 1, Lysozyme | PAR1_HUMAN 86-301 303-395, LYS_BPT4 1002-1161
+Non-standard residues in 3vw7 #329
+---
+CL — chloride ion
+NA — sodium ion
+OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
+VPX — ethyl
+[(1R,3aR,4aR,6R,8aR,9S,9aS)-9-{(E)-2-[5-(3-fluorophenyl)pyridin-2-yl]ethenyl}-1-methyl-3-oxododecahydronaphtho[2,3-c]fur
+an-6-yl]carbamate (vorapaxar)
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+atoms have anisotropic B-factors. Depict anisotropic information with
+Thermal Ellipsoids [start tool...] or the aniso command.
+Deleted 84 C-terminal residues, 207 N-terminal residues, 80 non-polymer
+residues more than 3.0 Angstroms away.
+Alignment of 3vw7 chain A to query has RMSD 1.34 using 58 of 125 paired
+residues within cutoff distance 2.0
+c83 title:
+Bacteriophage T4 lysozyme mutant D89A in wildtype background at room
+temperature [more info...]
+Chain information for 3c83 #330
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 3c83 #330
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 3c83 chain A to query has RMSD 0.962 using 47 of 125 paired
+residues within cutoff distance 2.0
+ou8 title:
+Structure of Spin-labeled T4 Lysozyme Mutant T115R1 at Room Temperature [more
+info...]
+Chain information for 2ou8 #331
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 2ou8 #331
+---
+BME — β-mercaptoethanol
+MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
+methanesulfonothioate (MTSL)
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 11 C-terminal residues, 2 N-terminal residues, 46 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 2ou8 chain A to query has RMSD 1.01 using 48 of 125 paired
+residues within cutoff distance 2.0
+l91 title:
+Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
+lysozyme have different structural and thermodynamic consequences [more
+info...]
+Chain information for 1l91 #332
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 1l91 #332
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l91 chain A to query has RMSD 1 using 48 of 125 paired residues
+within cutoff distance 2.0
+l76 title:
+Tolerance of T4 lysozyme to proline substitutions within the long interdomain
+α-helix illustrates the adaptability of proteins to potentially destabilizing
+lesions [more info...]
+Chain information for 1l76 #333
+---
+Chain | Description | UniProt
+A | LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1l76 #333
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l76 chain A to query has RMSD 0.95 using 44 of 124 paired
+residues within cutoff distance 2.0
+l24 title:
+Enhanced protein thermostability from site-directed mutations that decrease
+the entropy of unfolding [more info...]
+Chain information for 1l24 #334
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l24 chain A to query has RMSD 1.05 using 50 of 125 paired
+residues within cutoff distance 2.0
+l title:
+Generating ligand binding sites In T4 lysozyme using deficiency-creating
+substitutions [more info...]
+Chain information for 228l #335
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYCV_BPT4 1-164
+Non-standard residues in 228l #335
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 228l chain A to query has RMSD 0.952 using 47 of 125 paired
+residues within cutoff distance 2.0
+xep title:
+Catechol in complex with T4 lysozyme L99A/M102Q [more info...]
+Chain information for 1xep #336
+---
+Chain | Description | UniProt
+A | Lysozyme | LYS_BPT4 1-164
+Non-standard residues in 1xep #336
+---
+BME — β-mercaptoethanol
+CAQ — catechol (1,2-dihydroxybenzene)
+PO4 — phosphate ion
+atoms have alternate locations. Control/examine alternate locations with
+Altloc Explorer [start tool...] or the altlocs command.
+Deleted 9 C-terminal residues, 2 N-terminal residues, 140 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1xep chain A to query has RMSD 0.943 using 45 of 125 paired
+residues within cutoff distance 2.0
+l46 title:
+Cumulative site-directed charge-change replacements In bacteriophage T4
+lysozyme suggest that long-range electrostatic interactions contribute little
+to protein stability [more info...]
+Chain information for 1l46 #337
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 79 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l46 chain A to query has RMSD 0.981 using 47 of 127 paired
+residues within cutoff distance 2.0
+l20 title:
+Enhanced protein thermostability from designed mutations that interact with
+α-helix dipoles [more info...]
+Chain information for 1l20 #338
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Deleted 11 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l20 chain A to query has RMSD 0.993 using 47 of 124 paired
+residues within cutoff distance 2.0
+l03 title:
+Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
+phage T4 lysozyme [more info...]
+Chain information for 1l03 #339
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1l03 #339
+---
+BME — β-mercaptoethanol
+Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
+more than 3.0 Angstroms away.
+Alignment of 1l03 chain A to query has RMSD 1.03 using 49 of 125 paired
+residues within cutoff distance 2.0
+dyg title:
+Determination of α-helix propensity within the context of A folded protein:
+sites 44 and 131 In bacteriophage T4 lysozyme [more info...]
+Chain information for 1dyg #340
+---
+Chain | Description | UniProt
+A | T4 LYSOZYME | LYS_BPT4 1-164
+Non-standard residues in 1dyg #340
+---
+BME — β-mercaptoethanol
+CL — chloride ion
+[deleted to fit within ticket limits]
 Deleted 9 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues