![[ChimeraX Issue Tracking System]](/trac/ChimeraX/chrome/site/ChimeraX-icon.svg){kind=icon}
Opened 29 hours ago
Last modified 15 hours ago
#20389 closed defect
ChimeraX bug report submission — at Initial Version
| Reported by: | Owned by: | ||
|---|---|---|---|
| Priority: | normal | Milestone: | |
| Component: | Sequence | Version: | |
| Keywords: | Cc: | ||
| Blocked By: | Blocking: | ||
| Notify when closed: | Platform: | all | |
| Project: | ChimeraX |
Description
The following bug report has been submitted:
Platform: macOS-26.5-arm64-arm-64bit
ChimeraX Version: 1.11.1 (2026-01-23 05:51:34 UTC)
Description
Replace this text with list of actions that caused this problem to occur
Log:
UCSF ChimeraX version: 1.11.1 (2026-01-23)
© 2016-2025 Regents of the University of California. All rights reserved.
How to cite UCSF ChimeraX
> open 6ete fromDatabase pdb format mmcif
Summary of feedback from opening 6ete fetched from pdb
---
notes | Fetching compressed mmCIF 6ete from http://files.rcsb.org/download/6ete.cif
Fetching CCD BWK from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/K/BWK/BWK.cif
6ete title:
Crystal structure of KDM4D with tetrazolhydrazide compound 5 [more info...]
Chain information for 6ete #1
---
Chain | Description | UniProt
A | Lysine-specific demethylase 4D | KDM4D_HUMAN 1-342
Non-standard residues in 6ete #1
---
BWK — [2-(1-methyl-1,2,3,4-tetrazol-4-ium-5-yl)ethanoylamino]azanium
EDO — 1,2-ethanediol (ethylene glycol)
NI — nickel (II) ion
SO4 — sulfate ion
ZN — zinc ion
569 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
3090 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
> close #1
> open 6et6 fromDatabase pdb format mmcif
6et6 title:
Crystal structure of muramidase from Acinetobacter baumannii AB 5075UW
prophage [more info...]
Chain information for 6et6 #1
---
Chain | Description | UniProt
A | Lysozyme | A0A0D5YGK2_ACIBA 14-196
Non-standard residues in 6et6 #1
---
GOL — glycerol (glycerin; propane-1,2,3-triol)
SO4 — sulfate ion
13 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
1378 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
> open "/Users/gth_book/Documents/1_JOB_Files/Research_Proj_Prop/★
> Prop_2024_Enzybiotics ▲ 🌱/Structures_Analysis/Structures from
> PDB/AbLys1_8APP.cif"
AbLys1_8APP.cif title:
AbLys1 endolysin from Acinetobacter baumannii phage AbTZA1 [more info...]
Chain information for AbLys1_8APP.cif #2
---
Chain | Description | UniProt
A B C D | Endolysin | A0A3T0IGR7_9CAUD 1-187
Non-standard residues in AbLys1_8APP.cif #2
---
GOL — glycerol (glycerin; propane-1,2,3-triol)
PO4 — phosphate ion
AbLys1_8APP.cif mmCIF Assemblies
---
1| author_and_software_defined_assembly
> close #2
> open "/Users/gth_book/Documents/1_JOB_Files/Research_Proj_Prop/★
> Prop_2024_Enzybiotics ▲ 🌱/Structures_Analysis/Structure
> analysis/AbLys1_8APP_monom.pdb"
Chain information for AbLys1_8APP_monom.pdb #2
---
Chain | Description
A | No description available
> hide #2 models
> ui tool show Matchmaker
> matchmaker #2 to #1
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker 6et6, chain A (#1) with AbLys1_8APP_monom.pdb, chain A (#2),
sequence alignment score = 597.2
RMSD between 94 pruned atom pairs is 0.530 angstroms; (across all 149 pairs:
4.699)
> show #2 models
> hide #2 models
> hide #1 models
> close #1
> ui tool show "Similar Structures"
> foldseek /A
Found 463 similar structures to AbLys1_8APP_monom.pdb #2/A in pdb database
using foldseek, name fs1
> show #2 models
> open 6et6
6et6 title:
Crystal structure of muramidase from Acinetobacter baumannii AB 5075UW
prophage [more info...]
Chain information for 6et6 #1
---
Chain | Description | UniProt
A | Lysozyme | A0A0D5YGK2_ACIBA 14-196
Non-standard residues in 6et6 #1
---
GOL — glycerol (glycerin; propane-1,2,3-triol)
SO4 — sulfate ion
13 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
1378 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 3 N-terminal residues, 84 non-polymer residues more than 3.0 Angstroms
away.
Alignment of 6et6 chain A to query has RMSD 0.52 using 93 of 146 paired
residues within cutoff distance 2.0
> open 7m5i
7m5i title:
Endolysin from Escherichia coli O157:H7 phage FAHEc1 [more info...]
Chain information for 7m5i #3
---
Chain | Description | UniProt
A B | Endolysin | A0A0F6R9G3_9CAUD 1-154
Non-standard residues in 7m5i #3
---
PO4 — phosphate ion
7m5i mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
8 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
2475 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 7 C-terminal residues, 5 N-terminal residues, 213 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 7m5i chain B to query has RMSD 0.911 using 107 of 146 paired
residues within cutoff distance 2.0
> hide #2 models
> show #2 models
> hide #1 models
> select #2/A:159
14 atoms, 15 bonds, 1 residue, 1 model selected
> show sel atoms
> open 2anv
2anv title:
crystal structure of P22 lysozyme mutant L86M [more info...]
Chain information for 2anv #4
---
Chain | Description | UniProt
A B | Lysozyme | LYS_BPP22 1-146
Non-standard residues in 2anv #4
---
CL — chloride ion
IOD — iodide ion
MG — magnesium ion
SM — samarium (III) ion
SO4 — sulfate ion
2anv mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| software_defined_assembly
3| software_defined_assembly
165 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
2792 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 2 N-terminal residues, 378 non-polymer residues more
than 3.0 Angstroms away.
Alignment of 2anv chain A to query has RMSD 1.04 using 129 of 144 paired
residues within cutoff distance 2.0
> open 4zpu
4zpu title:
The structure of DLP12 endolysin exhibits likely active and inactive
conformations. [more info...]
Chain information for 4zpu #5
---
Chain | Description | UniProt
A B C D | Lysozyme RrrD | LYSD_ECOLI 1-165
Non-standard residues in 4zpu #5
---
ACT — acetate ion
FMT — formic acid
4zpu mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 3 extra chains, 5 C-terminal residues, 19 N-terminal residues, 45 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 4zpu chain A to query has RMSD 0.855 using 87 of 135 paired
residues within cutoff distance 2.0
> open 8hp8
8hp8 title:
Crystal Structure of Engineered Endolysin EC340 derived from Gram-Negative
Bacteria targeted Bacteriophage [more info...]
Chain information for 8hp8 #6
---
Chain | Description
A B C | Endolysin mtEC340M
8hp8 mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
Deleted 2 extra chains, 13 C-terminal residues, 2 N-terminal residues, 255
non-polymer residues more than 3.0 Angstroms away.
Alignment of 8hp8 chain C to query has RMSD 0.877 using 114 of 142 paired
residues within cutoff distance 2.0
> open 3hde
3hde title:
Crystal structure of full-length endolysin R21 from phage 21 [more info...]
Chain information for 3hde #7
---
Chain | Description | UniProt
A B C D | Lysozyme | LYS_BPP21 1-165
3hde mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 3 extra chains, 3 C-terminal residues, 19 N-terminal residues, 325
non-polymer residues more than 3.0 Angstroms away.
Alignment of 3hde chain C to query has RMSD 0.97 using 93 of 136 paired
residues within cutoff distance 2.0
> open 8b2s
8b2s title:
GH24 family muramidase from Trichophaea saccata with an SH3-like cell wall
binding domain [more info...]
Chain information for 8b2s #8
---
Chain | Description
A B | GH24 family muramidase
Non-standard residues in 8b2s #8
---
K — potassium ion
8b2s mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
37 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
3610 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 10 C-terminal residues, 79 N-terminal residues, 274
non-polymer residues more than 3.0 Angstroms away.
Alignment of 8b2s chain B to query has RMSD 0.925 using 101 of 145 paired
residues within cutoff distance 2.0
> open 1xjt
1xjt title:
Crystal structure of active form of P1 phage endolysin Lyz [more info...]
Chain information for 1xjt #9
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPP1 1-185
Non-standard residues in 1xjt #9
---
CIT — citric acid
Deleted 8 C-terminal residues, 73 non-polymer residues more than 3.0 Angstroms
away.
Alignment of 1xjt chain A to query has RMSD 1 using 80 of 158 paired residues
within cutoff distance 2.0
> open 3hde
3hde title:
Crystal structure of full-length endolysin R21 from phage 21 [more info...]
Chain information for 3hde #10
---
Chain | Description | UniProt
A B C D | Lysozyme | LYS_BPP21 1-165
3hde mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 3 extra chains, 4 C-terminal residues, 19 N-terminal residues, 327
non-polymer residues more than 3.0 Angstroms away.
Alignment of 3hde chain D to query has RMSD 0.782 using 80 of 126 paired
residues within cutoff distance 2.0
> open 1jqu
1jqu title:
Are Carboxy Terminii of Helices Coded by the Local Sequence or by Tertiary
Structure Contacts [more info...]
Chain information for 1jqu #11
---
Chain | Description | UniProt
A B C D | Lysozyme | LYS_BPT4 1-164
1jqu mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
4| author_defined_assembly
Deleted 3 extra chains, 11 C-terminal residues, 1 N-terminal residues, 23 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 1jqu chain C to query has RMSD 1.11 using 51 of 124 paired
residues within cutoff distance 2.0
> open 3fi5
3fi5 title:
Crystal Structure of T4 Lysozyme Mutant R96W [more info...]
Chain information for 3fi5 #12
---
Chain | Description | UniProt
A B C D | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3fi5 #12
---
CL — chloride ion
IPA — isopropyl alcohol (2-propanol)
NA — sodium ion
3fi5 mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
3| author_and_software_defined_assembly
4| author_and_software_defined_assembly
360 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
5242 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 3 extra chains, 9 C-terminal residues, 2 N-terminal residues, 902 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 3fi5 chain C to query has RMSD 0.948 using 46 of 124 paired
residues within cutoff distance 2.0
> open 6a73
6a73 title:
Complex structure of CSN2 with IP6 [more info...]
Chain information for 6a73 #13
---
Chain | Description | UniProt
A B | COP9 signalosome complex subunit 2,Endolysin | CSN2_HUMAN 29-162, A0A097J809_BPT4 163-325
Non-standard residues in 6a73 #13
---
IHP — inositol hexakisphosphate (myo-inositol hexakisphosphate; inositol
1,2,3,4,5,6-hexakisphosphate)
SO4 — sulfate ion
6a73 mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
4968 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 8 C-terminal residues, 95 N-terminal residues, 137
non-polymer residues more than 3.0 Angstroms away.
Alignment of 6a73 chain B to query has RMSD 1.17 using 64 of 153 paired
residues within cutoff distance 2.0
> open 192l
Summary of feedback from opening 192l fetched from pdb
---
note | Fetching compressed mmCIF 192l from http://files.rcsb.org/download/192l.cif
192l title:
A helix initiation signal In T4 lysozyme identified by polyalanine mutagenesis
[more info...]
Chain information for 192l #14
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 192l #14
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 7 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 192l chain A to query has RMSD 0.836 using 41 of 127 paired
residues within cutoff distance 2.0
> close
> open "/Users/gth_book/Documents/1_JOB_Files/Research_Proj_Prop/★
> Prop_2024_Enzybiotics ▲ 🌱/Structures_Analysis/Structure
> analysis/AbLys1_8APP_monom.pdb"
Chain information for AbLys1_8APP_monom.pdb #1
---
Chain | Description
A | No description available
> open 6et6
6et6 title:
Crystal structure of muramidase from Acinetobacter baumannii AB 5075UW
prophage [more info...]
Chain information for 6et6 #2
---
Chain | Description | UniProt
A | Lysozyme | A0A0D5YGK2_ACIBA 14-196
Non-standard residues in 6et6 #2
---
GOL — glycerol (glycerin; propane-1,2,3-triol)
SO4 — sulfate ion
13 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
1378 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 3 N-terminal residues, 84 non-polymer residues more than 3.0 Angstroms
away.
> close #2
> foldseek /A
Found 404 similar structures to AbLys1_8APP_monom.pdb #1/A in pdb database
using foldseek, name fs2
> open 6et6
6et6 title:
Crystal structure of muramidase from Acinetobacter baumannii AB 5075UW
prophage [more info...]
Chain information for 6et6 #2
---
Chain | Description | UniProt
A | Lysozyme | A0A0D5YGK2_ACIBA 14-196
Non-standard residues in 6et6 #2
---
GOL — glycerol (glycerin; propane-1,2,3-triol)
SO4 — sulfate ion
13 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
1378 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 3 N-terminal residues, 84 non-polymer residues more than 3.0 Angstroms
away.
Alignment of 6et6 chain A to query has RMSD 0.52 using 93 of 146 paired
residues within cutoff distance 2.0
> similarstructures sequences
> similarstructures traces
404 backbone traces
> close #3
> similarstructures cluster #1/A:131,64,88,177,69 clusterDistance 1.5
Clustered 392 of 404 hits that have the specified 5 residues into 2 groups
> similarstructures sequences
> color byattribute r:coverage #1/A palette 0,red:202,white:404,blue
1631 atoms, 342 residues, atom coverage range 1 to 404
> color byattribute r:conservation #1/A palette 0,blue:0.25,white:0.5,red
1631 atoms, 342 residues, atom conservation range 0.176 to 1
> color #1/A gray
> color #1/A & ::conservation>=0.5 red
> color byattribute r:lddt #1/A palette
> 0,red:0.2,orange:0.4,yellow:0.6,cornflowerblue:0.8,blue
1631 atoms, 342 residues, atom lddt range 0.337 to 1
7m5i title:
Endolysin from Escherichia coli O157:H7 phage FAHEc1 [more info...]
Chain information for 7m5i #3
---
Chain | Description | UniProt
A B | Endolysin | A0A0F6R9G3_9CAUD 1-154
Non-standard residues in 7m5i #3
---
PO4 — phosphate ion
7m5i mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
8 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
2475 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 7 C-terminal residues, 5 N-terminal residues, 213 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 7m5i chain B to query has RMSD 0.911 using 107 of 146 paired
residues within cutoff distance 2.0
6h9d title:
Muramidase domain of SpmX from Asticaccaulis excentricus [more info...]
Chain information for 6h9d #4
---
Chain | Description | UniProt
A B C | Lysozyme | E8RMG8_ASTEC 2-150
Non-standard residues in 6h9d #4
---
CL — chloride ion
GOL — glycerol (glycerin; propane-1,2,3-triol)
6h9d mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
5 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 2 extra chains, 2 N-terminal residues, 132 non-polymer residues more
than 3.0 Angstroms away.
Alignment of 6h9d chain C to query has RMSD 0.804 using 99 of 145 paired
residues within cutoff distance 2.0
2anv title:
crystal structure of P22 lysozyme mutant L86M [more info...]
Chain information for 2anv #5
---
Chain | Description | UniProt
A B | Lysozyme | LYS_BPP22 1-146
Non-standard residues in 2anv #5
---
CL — chloride ion
IOD — iodide ion
MG — magnesium ion
SM — samarium (III) ion
SO4 — sulfate ion
2anv mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| software_defined_assembly
3| software_defined_assembly
165 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
2792 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 2 N-terminal residues, 378 non-polymer residues more
than 3.0 Angstroms away.
Alignment of 2anv chain A to query has RMSD 1.04 using 129 of 144 paired
residues within cutoff distance 2.0
4zpu title:
The structure of DLP12 endolysin exhibits likely active and inactive
conformations. [more info...]
Chain information for 4zpu #6
---
Chain | Description | UniProt
A B C D | Lysozyme RrrD | LYSD_ECOLI 1-165
Non-standard residues in 4zpu #6
---
ACT — acetate ion
FMT — formic acid
4zpu mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 3 extra chains, 5 C-terminal residues, 19 N-terminal residues, 45 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 4zpu chain A to query has RMSD 0.855 using 87 of 135 paired
residues within cutoff distance 2.0
8hp8 title:
Crystal Structure of Engineered Endolysin EC340 derived from Gram-Negative
Bacteria targeted Bacteriophage [more info...]
Chain information for 8hp8 #7
---
Chain | Description
A B C | Endolysin mtEC340M
8hp8 mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
Deleted 2 extra chains, 13 C-terminal residues, 2 N-terminal residues, 255
non-polymer residues more than 3.0 Angstroms away.
Alignment of 8hp8 chain C to query has RMSD 0.877 using 114 of 142 paired
residues within cutoff distance 2.0
3hde title:
Crystal structure of full-length endolysin R21 from phage 21 [more info...]
Chain information for 3hde #8
---
Chain | Description | UniProt
A B C D | Lysozyme | LYS_BPP21 1-165
3hde mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 3 extra chains, 3 C-terminal residues, 19 N-terminal residues, 325
non-polymer residues more than 3.0 Angstroms away.
Alignment of 3hde chain C to query has RMSD 0.97 using 93 of 136 paired
residues within cutoff distance 2.0
8b2s title:
GH24 family muramidase from Trichophaea saccata with an SH3-like cell wall
binding domain [more info...]
Chain information for 8b2s #9
---
Chain | Description
A B | GH24 family muramidase
Non-standard residues in 8b2s #9
---
K — potassium ion
8b2s mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
37 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
3610 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 10 C-terminal residues, 79 N-terminal residues, 274
non-polymer residues more than 3.0 Angstroms away.
Alignment of 8b2s chain B to query has RMSD 0.925 using 101 of 145 paired
residues within cutoff distance 2.0
1xjt title:
Crystal structure of active form of P1 phage endolysin Lyz [more info...]
Chain information for 1xjt #10
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPP1 1-185
Non-standard residues in 1xjt #10
---
CIT — citric acid
Deleted 8 C-terminal residues, 73 non-polymer residues more than 3.0 Angstroms
away.
Alignment of 1xjt chain A to query has RMSD 1 using 80 of 158 paired residues
within cutoff distance 2.0
3hde title:
Crystal structure of full-length endolysin R21 from phage 21 [more info...]
Chain information for 3hde #11
---
Chain | Description | UniProt
A B C D | Lysozyme | LYS_BPP21 1-165
3hde mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 3 extra chains, 4 C-terminal residues, 19 N-terminal residues, 327
non-polymer residues more than 3.0 Angstroms away.
Alignment of 3hde chain D to query has RMSD 0.782 using 80 of 126 paired
residues within cutoff distance 2.0
1jqu title:
Are Carboxy Terminii of Helices Coded by the Local Sequence or by Tertiary
Structure Contacts [more info...]
Chain information for 1jqu #12
---
Chain | Description | UniProt
A B C D | Lysozyme | LYS_BPT4 1-164
1jqu mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
4| author_defined_assembly
Deleted 3 extra chains, 11 C-terminal residues, 1 N-terminal residues, 23 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 1jqu chain C to query has RMSD 1.11 using 51 of 124 paired
residues within cutoff distance 2.0
3fi5 title:
Crystal Structure of T4 Lysozyme Mutant R96W [more info...]
Chain information for 3fi5 #13
---
Chain | Description | UniProt
A B C D | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3fi5 #13
---
CL — chloride ion
IPA — isopropyl alcohol (2-propanol)
NA — sodium ion
3fi5 mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
3| author_and_software_defined_assembly
4| author_and_software_defined_assembly
360 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
5242 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 3 extra chains, 9 C-terminal residues, 2 N-terminal residues, 902 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 3fi5 chain C to query has RMSD 0.948 using 46 of 124 paired
residues within cutoff distance 2.0
6a73 title:
Complex structure of CSN2 with IP6 [more info...]
Chain information for 6a73 #14
---
Chain | Description | UniProt
A B | COP9 signalosome complex subunit 2,Endolysin | CSN2_HUMAN 29-162, A0A097J809_BPT4 163-325
Non-standard residues in 6a73 #14
---
IHP — inositol hexakisphosphate (myo-inositol hexakisphosphate; inositol
1,2,3,4,5,6-hexakisphosphate)
SO4 — sulfate ion
6a73 mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
4968 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 8 C-terminal residues, 95 N-terminal residues, 137
non-polymer residues more than 3.0 Angstroms away.
Alignment of 6a73 chain B to query has RMSD 1.17 using 64 of 153 paired
residues within cutoff distance 2.0
192l title:
A helix initiation signal In T4 lysozyme identified by polyalanine mutagenesis
[more info...]
Chain information for 192l #15
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 192l #15
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 7 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 192l chain A to query has RMSD 0.836 using 41 of 127 paired
residues within cutoff distance 2.0
137l title:
Structural basis of amino acid α helix propensity [more info...]
Chain information for 137l #16
---
Chain | Description | UniProt
A B | T4 LYSOZYME | LYS_BPT4 1-164
137l mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 186
non-polymer residues more than 3.0 Angstroms away.
Alignment of 137l chain B to query has RMSD 0.973 using 49 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 5vnq from http://files.rcsb.org/download/5vnq.cif
Atom D1 is not in the residue template for MET /A:1
Atom D is not in the residue template for ASN /A:2
Atom D is not in the residue template for ILE /A:3
Atom D is not in the residue template for PHE /A:4
Atom D is not in the residue template for GLU /A:5
Atom D is not in the residue template for MET /A:6
Atom D is not in the residue template for LEU /A:7
Atom D is not in the residue template for ARG /A:8
Atom D is not in the residue template for ILE /A:9
Too many hydrogens missing from residue template(s) to warn about
5vnq title:
Neutron crystallographic structure of perdeuterated T4 lysozyme cysteine-free
pseudo-wild type at cryogenic temperature [more info...]
Chain information for 5vnq #17
---
Chain | Description | UniProt
A | Endolysin | D9IEF7_BPT4 1-164
Non-standard residues in 5vnq #17
---
CL — chloride ion
656 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 4 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 5vnq chain A to query has RMSD 0.995 using 48 of 126 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 5kim from http://files.rcsb.org/download/5kim.cif
Fetching CCD PHI from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/I/PHI/PHI.cif
5kim title:
Pseudo T4 lysozyme mutant - Y88PHE-I [more info...]
Chain information for 5kim #18
---
Chain | Description | UniProt
A | Endolysin | ENLYS_BPT4 1-164
Non-standard residues in 5kim #18
---
HED — 2-hydroxyethyl disulfide
NA — sodium ion
138 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 9 C-terminal residues, 2 N-terminal residues, 204 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 5kim chain A to query has RMSD 0.968 using 49 of 124 paired
residues within cutoff distance 2.0
5jgx title:
Spin-Labeled T4 Lysozyme Construct V131V1 [more info...]
Chain information for 5jgx #19
---
Chain | Description | UniProt
A | Endolysin | ENLYS_BPT4 1-164
Non-standard residues in 5jgx #19
---
CL — chloride ion
K — potassium ion
PO4 — phosphate ion
V1A — S-(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-imidazol-4-yl)
methanesulfonothioate
37 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 162 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 5jgx chain A to query has RMSD 0.993 using 50 of 124 paired
residues within cutoff distance 2.0
3hdf title:
Crystal structure of truncated endolysin R21 from phage 21 [more info...]
Chain information for 3hdf #20
---
Chain | Description | UniProt
A B | Lysozyme | LYS_BPP21 27-165
Non-standard residues in 3hdf #20
---
GOL — glycerol (glycerin; propane-1,2,3-triol)
NO3 — nitrate ion
3hdf mmCIF Assemblies
---
1| software_defined_assembly
2| software_defined_assembly
17 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 1 extra chains, 1 C-terminal residues, 3 N-terminal residues, 245 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 3hdf chain B to query has RMSD 1.17 using 67 of 124 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 2o79 from http://files.rcsb.org/download/2o79.cif
2o79 title:
T4 lysozyme with C-terminal extension [more info...]
Chain information for 2o79 #21
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 2o79 #21
---
CL — chloride ion
GOL — glycerol (glycerin; propane-1,2,3-triol)
PO4 — phosphate ion
31 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 9 C-terminal residues, 2 N-terminal residues, 113 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 2o79 chain A to query has RMSD 1 using 50 of 125 paired residues
within cutoff distance 2.0
Fetching compressed mmCIF 216l from http://files.rcsb.org/download/216l.cif
216l title:
Structural basis of α-helix propensity At two sites In T4 lysozyme [more
info...]
Chain information for 216l #22
---
Chain | Description | UniProt
A B | T4 LYSOZYME | LYS_BPT4 1-164
216l mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 14 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 216l chain B to query has RMSD 0.964 using 47 of 122 paired
residues within cutoff distance 2.0
5jgu title:
Spin-Labeled T4 Lysozyme Construct R119V1 [more info...]
Chain information for 5jgu #23
---
Chain | Description | UniProt
A | Endolysin | ENLYS_BPT4 1-164
Non-standard residues in 5jgu #23
---
CL — chloride ion
K — potassium ion
PO4 — phosphate ion
V1A — S-(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-imidazol-4-yl)
methanesulfonothioate
42 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 157 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 5jgu chain A to query has RMSD 0.984 using 50 of 125 paired
residues within cutoff distance 2.0
4arj title:
Crystal structure of a pesticin (translocation and receptor binding domain)
from Y. pestis and T4-lysozyme chimera [more info...]
Chain information for 4arj #24
---
Chain | Description | UniProt
A B | PESTICIN, LYSOZYME | Q57159_YERPE 1-167, LYS_BPT4 169-331
Non-standard residues in 4arj #24
---
SO4 — sulfate ion
4arj mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
11 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
5079 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 14 C-terminal residues, 136 N-terminal residues, 57
non-polymer residues more than 3.0 Angstroms away.
Alignment of 4arj chain B to query has RMSD 0.996 using 59 of 140 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 3sb6 from http://files.rcsb.org/download/3sb6.cif
Fetching CCD CU from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/U/CU/CU.cif
3sb6 title:
Cu-mediated Dimer of T4 Lysozyme D61H/K65H/R76H/R80H by Synthetic
Symmetrization [more info...]
Chain information for 3sb6 #25
---
Chain | Description | UniProt
A B | Lysozyme | LYS_BPT4 1-162
Non-standard residues in 3sb6 #25
---
CL — chloride ion
CU — copper (II) ion
2536 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 9 C-terminal residues, 4 N-terminal residues, 19 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 3sb6 chain A to query has RMSD 0.957 using 46 of 127 paired
residues within cutoff distance 2.0
137l title:
Structural basis of amino acid α helix propensity [more info...]
Chain information for 137l #26
---
Chain | Description | UniProt
A B | T4 LYSOZYME | LYS_BPT4 1-164
137l mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 168 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 137l chain A to query has RMSD 1 using 49 of 125 paired residues
within cutoff distance 2.0
Fetching compressed mmCIF 2q9d from http://files.rcsb.org/download/2q9d.cif
2q9d title:
Structure of spin-labeled T4 lysozyme mutant A41R1 [more info...]
Chain information for 2q9d #27
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 2q9d #27
---
BME — β-mercaptoethanol
MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
methanesulfonothioate (MTSL)
1556 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 99 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 2q9d chain A to query has RMSD 1.03 using 51 of 124 paired
residues within cutoff distance 2.0
217l title:
Structural basis of α-helix propensity At two sites In T4 lysozyme [more
info...]
Chain information for 217l #28
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 217l #28
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 86 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 217l chain A to query has RMSD 0.98 using 48 of 124 paired
residues within cutoff distance 2.0
201l title:
How amino-acid insertions are allowed In an α-helix of T4 lysozyme [more
info...]
Chain information for 201l #29
---
Chain | Description | UniProt
A B | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 201l #29
---
BME — β-mercaptoethanol
201l mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 85 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 201l chain B to query has RMSD 0.984 using 50 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 6pgz from http://files.rcsb.org/download/6pgz.cif
6pgz title:
MTSL labelled T4 lysozyme pseudo-wild type V75C mutant [more info...]
Chain information for 6pgz #30
---
Chain | Description | UniProt
A B | Endolysin | D9IEF7_BPT4 1-164
Non-standard residues in 6pgz #30
---
CL — chloride ion
MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
methanesulfonothioate (MTSL)
6pgz mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 51 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 6pgz chain B to query has RMSD 0.999 using 48 of 124 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 5ki1 from http://files.rcsb.org/download/5ki1.cif
5ki1 title:
Pseudo T4 lysozyme mutant - Y18F [more info...]
Chain information for 5ki1 #31
---
Chain | Description | UniProt
A | Endolysin | ENLYS_BPT4 1-164
Non-standard residues in 5ki1 #31
---
HED — 2-hydroxyethyl disulfide
22 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 9 C-terminal residues, 2 N-terminal residues, 161 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 5ki1 chain A to query has RMSD 1.01 using 49 of 126 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 5jgn from http://files.rcsb.org/download/5jgn.cif
5jgn title:
Spin-Labeled T4 Lysozyme Construct I9V1 [more info...]
Chain information for 5jgn #32
---
Chain | Description | UniProt
A | Endolysin | ENLYS_BPT4 1-164
Non-standard residues in 5jgn #32
---
CL — chloride ion
K — potassium ion
PO4 — phosphate ion
V1A — S-(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-imidazol-4-yl)
methanesulfonothioate
33 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 168 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 5jgn chain A to query has RMSD 0.959 using 49 of 124 paired
residues within cutoff distance 2.0
1t97 title:
Use of sequence duplication to engineer a ligand-triggered long-distance
molecular switch in T4 Lysozyme [more info...]
Chain information for 1t97 #33
---
Chain | Description | UniProt
A B | Lysozyme | LYS_BPT4 1-175
1t97 mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 55 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 1t97 chain B to query has RMSD 1.01 using 50 of 129 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1l73 from http://files.rcsb.org/download/1l73.cif
1l73 title:
Multiple stabilizing alanine replacements within α-helix 126-134 of T4
lysozyme have independent, additive effects on both structure and stability
[more info...]
Chain information for 1l73 #34
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l73 #34
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l73 chain A to query has RMSD 0.93 using 44 of 124 paired
residues within cutoff distance 2.0
1epy title:
T4 lysozyme mutant, T21H/C54T/C97A/Q141H/T142H [more info...]
Chain information for 1epy #35
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1epy #35
---
CL — chloride ion
CO — cobalt (II) ion
SO4 — sulfate ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1epy chain A to query has RMSD 0.924 using 45 of 127 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 168l from http://files.rcsb.org/download/168l.cif
168l title:
Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
[more info...]
Chain information for 168l #36
---
Chain | Description | UniProt
A B C D E | T4 LYSOZYME | LYS_BPT4 1-164
168l mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
4| author_defined_assembly
5| author_defined_assembly
Deleted 4 extra chains, 11 C-terminal residues, 2 N-terminal residues.
Alignment of 168l chain B to query has RMSD 1.18 using 67 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 6v51 from http://files.rcsb.org/download/6v51.cif
Fetching CCD QPM from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/M/QPM/QPM.cif
6v51 title:
Spin-labeled T4 Lysozyme (9/131FnbY)-(4-Amino-TEMPO) [more info...]
Chain information for 6v51 #37
---
Chain | Description | UniProt
A | Endolysin | D9IEF7_BPT4 1-164
Non-standard residues in 6v51 #37
---
QPM — 4-amino-2,2,6,6-tetramethylpiperidin-1-ol (4-Amino-TEMPO)
12 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 83 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 6v51 chain A to query has RMSD 0.927 using 48 of 126 paired
residues within cutoff distance 2.0
4arj title:
Crystal structure of a pesticin (translocation and receptor binding domain)
from Y. pestis and T4-lysozyme chimera [more info...]
Chain information for 4arj #38
---
Chain | Description | UniProt
A B | PESTICIN, LYSOZYME | Q57159_YERPE 1-167, LYS_BPT4 169-331
Non-standard residues in 4arj #38
---
SO4 — sulfate ion
4arj mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
11 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
5079 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 14 C-terminal residues, 137 N-terminal residues, 61
non-polymer residues more than 3.0 Angstroms away.
Alignment of 4arj chain A to query has RMSD 0.987 using 54 of 136 paired
residues within cutoff distance 2.0
2hum title:
Crystal structure of T4 Lysozyme D72C synthetic dimer [more info...]
Chain information for 2hum #39
---
Chain | Description | UniProt
A B | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 2hum #39
---
TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer)
Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 61 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 2hum chain A to query has RMSD 0.953 using 49 of 125 paired
residues within cutoff distance 2.0
1l26 title:
Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
protein stability [more info...]
Chain information for 1l26 #40
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l26 #40
---
BME — β-mercaptoethanol
1 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l26 chain A to query has RMSD 1.06 using 49 of 125 paired
residues within cutoff distance 2.0
1l77 title:
Design and structural analysis of alternative hydrophobic core packing
arrangements In bacteriophage T4 lysozyme [more info...]
Chain information for 1l77 #41
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l77 #41
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 7 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l77 chain A to query has RMSD 0.983 using 49 of 127 paired
residues within cutoff distance 2.0
1l75 title:
Multiple stabilizing alanine replacements within α-helix 126-134 of T4
lysozyme have independent, additive effects on both structure and stability
[more info...]
Chain information for 1l75 #42
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l75 #42
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l75 chain A to query has RMSD 0.852 using 42 of 127 paired
residues within cutoff distance 2.0
175l title:
Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
[more info...]
Chain information for 175l #43
---
Chain | Description | UniProt
A B | T4 LYSOZYME | LYS_BPT4 1-164
175l mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 58 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 175l chain B to query has RMSD 0.922 using 46 of 127 paired
residues within cutoff distance 2.0
145l title:
Role of backbone flexibility In the accommodation of variants that repack the
core of T4 lysozyme [more info...]
Chain information for 145l #44
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 145l #44
---
BME — β-mercaptoethanol
Deleted 9 C-terminal residues, 2 N-terminal residues, 34 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 145l chain A to query has RMSD 0.931 using 49 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 6cm4 from http://files.rcsb.org/download/6cm4.cif
Fetching CCD 8NU from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/U/8NU/8NU.cif
Fetching CCD PEG from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/G/PEG/PEG.cif
6cm4 title:
Structure of the D2 Dopamine Receptor Bound to the Atypical Antipsychotic Drug
Risperidone [more info...]
Chain information for 6cm4 #45
---
Chain | Description | UniProt
A | D(2) dopamine receptor, endolysin chimera | DRD2_HUMAN 35-222 362-443, D9IEF7_BPT4 1002-1161
Non-standard residues in 6cm4 #45
---
8NU —
3-[2-[4-(6-fluoranyl-1,2-benzoxazol-3-yl)piperidin-1-yl]ethyl]-2-methyl-6,7,8,9-tetrahydropyrido[1,2-a]pyrimidin-4-one
OLA — oleic acid
PEG — di(hydroxyethyl)ether
2991 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 87 C-terminal residues, 184 N-terminal residues, 21 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 6cm4 chain A to query has RMSD 1.02 using 55 of 126 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 3g3x from http://files.rcsb.org/download/3g3x.cif
3g3x title:
Crystal structure of spin labeled T4 Lysozyme (T151R1) at 100 K [more info...]
Chain information for 3g3x #46
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3g3x #46
---
AZI — azide ion
CL — chloride ion
HED — 2-hydroxyethyl disulfide
MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
methanesulfonothioate (MTSL)
26 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3g3x chain A to query has RMSD 0.973 using 49 of 126 paired
residues within cutoff distance 2.0
1zyt title:
Crystal structure of spin labeled T4 Lysozyme (A82R1) [more info...]
Chain information for 1zyt #47
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 1zyt #47
---
AZI — azide ion
CL — chloride ion
HED — 2-hydroxyethyl disulfide
MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
methanesulfonothioate (MTSL)
17 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 104 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 1zyt chain A to query has RMSD 0.98 using 50 of 124 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 3sb8 from http://files.rcsb.org/download/3sb8.cif
3sb8 title:
Cu-mediated Dimer of T4 Lysozyme D61H/K65H by Synthetic Symmetrization [more
info...]
Chain information for 3sb8 #48
---
Chain | Description | UniProt
A B C | Lysozyme | LYS_BPT4 1-162
Non-standard residues in 3sb8 #48
---
CU — copper (II) ion
3sb8 mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
Deleted 2 extra chains, 9 C-terminal residues, 5 N-terminal residues, 9 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 3sb8 chain A to query has RMSD 0.981 using 49 of 127 paired
residues within cutoff distance 2.0
238l title:
The response of T4 lysozyme to large-to-small substitutions within the core
and its relation to the hydrophobic effect [more info...]
Chain information for 238l #49
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 238l #49
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 238l chain A to query has RMSD 0.934 using 46 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1p46 from http://files.rcsb.org/download/1p46.cif
1p46 title:
T4 lysozyme core repacking mutant M106I/TA [more info...]
Chain information for 1p46 #50
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1p46 #50
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
K — potassium ion
24 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 116 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 1p46 chain A to query has RMSD 0.99 using 52 of 125 paired
residues within cutoff distance 2.0
1l65 title:
Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A
polyalanine α-helix containing ten consecutive alanines [more info...]
Chain information for 1l65 #51
---
Chain | Description | UniProt
A | LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l65 #51
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 53 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l65 chain A to query has RMSD 1.01 using 49 of 124 paired
residues within cutoff distance 2.0
1g0k title:
Crystal structure of T4 lysozyme mutant T152C [more info...]
Chain information for 1g0k #52
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1g0k #52
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 11 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1g0k chain A to query has RMSD 0.999 using 49 of 125 paired
residues within cutoff distance 2.0
8gtm title:
Corticotropin-releasing hormone receptor 1(CRF1R) bound with BMK-C203 by XFEL
[more info...]
Chain information for 8gtm #53
---
Chain | Description | UniProt
A | Isoform CRF-R2 of Corticotropin-releasing factor receptor 1 | CRFR1_HUMAN 104-373
B | Endolysin | A0A346FJK3_BPT6 1000-1159
Non-standard residues in 8gtm #53
---
0VI — 7-(4-bromanyl-2,6-dimethoxy-
phenyl)-4,8-dimethyl-~{N},~{N}-bis[4,4,4-tris(fluoranyl)butyl]-1$l^{4},3,5,9-tetrazabicyclo[4.3.0]nona-1(6),2,4,8-tetraen-2-amine
Deleted 1 extra chains, 8 C-terminal residues, 1 N-terminal residues, 1 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 8gtm chain B to query has RMSD 1.28 using 69 of 126 paired
residues within cutoff distance 2.0
3sba title:
Zn-mediated Hexamer of T4 Lysozyme R76H/R80H by Synthetic Symmetrization [more
info...]
Chain information for 3sba #54
---
Chain | Description | UniProt
A B C D E F | Lysozyme | LYS_BPT4 1-162
Non-standard residues in 3sba #54
---
CL — chloride ion
ZN — zinc ion
7770 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 5 extra chains, 9 C-terminal residues, 3 N-terminal residues, 6 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 3sba chain E to query has RMSD 1.35 using 57 of 127 paired
residues within cutoff distance 2.0
3c8r title:
Contributions of all 20 amino acids at site 96 to stability and structure of
T4 lysozyme [more info...]
Chain information for 3c8r #55
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3c8r #55
---
BME — β-mercaptoethanol
CL — chloride ion
13 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 22 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3c8r chain A to query has RMSD 1 using 48 of 125 paired residues
within cutoff distance 2.0
2ntg title:
Structure of Spin-labeled T4 Lysozyme Mutant T115R7 [more info...]
Chain information for 2ntg #56
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 2ntg #56
---
BME — β-mercaptoethanol
R7A —
S-[(4-bromo-1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
methanesulfonothioate
253 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 122 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 2ntg chain A to query has RMSD 0.999 using 50 of 124 paired
residues within cutoff distance 2.0
1g06 title:
Crystal structure of T4 lysozyme mutant V149S [more info...]
Chain information for 1g06 #57
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1g06 #57
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1g06 chain A to query has RMSD 0.994 using 48 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 177l from http://files.rcsb.org/download/177l.cif
177l title:
Protein flexibility and adaptability seen in 25 crystal forms of T4 LYSOZYME
[more info...]
Chain information for 177l #58
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 9 C-terminal residues, 2 N-terminal residues, 3 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 177l chain A to query has RMSD 0.986 using 46 of 125 paired
residues within cutoff distance 2.0
122l title:
The energetic cost and the structural consequences of burying A hydroxyl group
within the core of A protein determined from ala to ser and val to THR
substitutions In T4 lysozyme [more info...]
Chain information for 122l #59
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 122l #59
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 122l chain A to query has RMSD 1.03 using 50 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 103l from http://files.rcsb.org/download/103l.cif
103l title:
How amino-acid insertions are allowed In an α-helix of T4 lysozyme [more
info...]
Chain information for 103l #60
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 103l #60
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 103l chain A to query has RMSD 0.898 using 45 of 124 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 5kio from http://files.rcsb.org/download/5kio.cif
5kio title:
Pseudo T4 lysozyme mutant - Y18PHE-I [more info...]
Chain information for 5kio #61
---
Chain | Description | UniProt
A | Endolysin | ENLYS_BPT4 1-164
Non-standard residues in 5kio #61
---
HED — 2-hydroxyethyl disulfide
75 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 9 C-terminal residues, 2 N-terminal residues, 133 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 5kio chain A to query has RMSD 0.971 using 48 of 126 paired
residues within cutoff distance 2.0
3pbl title:
Structure of the human dopamine D3 receptor in complex with eticlopride [more
info...]
Chain information for 3pbl #62
---
Chain | Description | UniProt
A B | D(3) dopamine receptor, Lysozyme chimera | DRD3_HUMAN 2-221 319-400, LYS_BPT4 1002-1161
Non-standard residues in 3pbl #62
---
ETQ —
3-chloro-5-ethyl-N-{[(2S)-1-ethylpyrrolidin-2-yl]methyl}-6-hydroxy-2-methoxybenzamide
GLC — alpha-D-glucopyranose (alpha-D-glucose; D-glucose; glucose)
3pbl mmCIF Assemblies
---
1| software_defined_assembly
2| software_defined_assembly
6695 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 90 C-terminal residues, 191 N-terminal residues, 4
non-polymer residues more than 3.0 Angstroms away.
Alignment of 3pbl chain A to query has RMSD 0.95 using 47 of 127 paired
residues within cutoff distance 2.0
1p2l title:
T4 Lysozyme Core Repacking Mutant V87I/TA [more info...]
Chain information for 1p2l #63
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1p2l #63
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
K — potassium ion
PO4 — phosphate ion
41 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 114 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 1p2l chain A to query has RMSD 0.943 using 48 of 124 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1l82 from http://files.rcsb.org/download/1l82.cif
1l82 title:
Design and structural analysis of alternative hydrophobic core packing
arrangements In bacteriophage T4 lysozyme [more info...]
Chain information for 1l82 #64
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l82 #64
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l82 chain A to query has RMSD 1.01 using 48 of 124 paired
residues within cutoff distance 2.0
1l36 title:
Toward A simplification of the protein folding problem: A stabilizing
polyalanine α-helix engineered In T4 lysozyme [more info...]
Chain information for 1l36 #65
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l36 #65
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l36 chain A to query has RMSD 1.02 using 47 of 125 paired
residues within cutoff distance 2.0
162l title:
Control of enzyme activity by an engineered disulfide bond [more info...]
Chain information for 162l #66
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 162l #66
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 162l chain A to query has RMSD 0.995 using 48 of 125 paired
residues within cutoff distance 2.0
3pbl title:
Structure of the human dopamine D3 receptor in complex with eticlopride [more
info...]
Chain information for 3pbl #67
---
Chain | Description | UniProt
A B | D(3) dopamine receptor, Lysozyme chimera | DRD3_HUMAN 2-221 319-400, LYS_BPT4 1002-1161
Non-standard residues in 3pbl #67
---
ETQ —
3-chloro-5-ethyl-N-{[(2S)-1-ethylpyrrolidin-2-yl]methyl}-6-hydroxy-2-methoxybenzamide
GLC — alpha-D-glucopyranose (alpha-D-glucose; D-glucose; glucose)
3pbl mmCIF Assemblies
---
1| software_defined_assembly
2| software_defined_assembly
6695 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 90 C-terminal residues, 167 N-terminal residues, 5
non-polymer residues more than 3.0 Angstroms away.
Alignment of 3pbl chain B to query has RMSD 1 using 46 of 142 paired residues
within cutoff distance 2.0
232l title:
T4 lysozyme mutant M120K [more info...]
Chain information for 232l #68
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 232l #68
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 232l chain A to query has RMSD 0.973 using 48 of 125 paired
residues within cutoff distance 2.0
1tla title:
Hydrophobic core repacking and aromatic-aromatic interaction In the
thermostable mutant of T4 lysozyme ser 117 (right arrow) phe [more info...]
Chain information for 1tla #69
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1tla #69
---
CL — chloride ion
PO4 — phosphate ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1tla chain A to query has RMSD 1.04 using 50 of 125 paired
residues within cutoff distance 2.0
1g0g title:
Crystal structure of T4 lysozyme mutant T152A [more info...]
Chain information for 1g0g #70
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1g0g #70
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1g0g chain A to query has RMSD 0.987 using 49 of 125 paired
residues within cutoff distance 2.0
172l title:
Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
[more info...]
Chain information for 172l #71
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 172l #71
---
BME — β-mercaptoethanol
Deleted 11 C-terminal residues, 2 N-terminal residues, 20 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 172l chain A to query has RMSD 1.26 using 69 of 124 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 5w0p from http://files.rcsb.org/download/5w0p.cif
5w0p title:
Crystal structure of rhodopsin bound to visual arrestin determined by X-ray
free electron laser [more info...]
Chain information for 5w0p #72
---
Chain | Description | UniProt
A B C D | Endolysin,Rhodopsin,S-arrestin | A0A097J792_BPT4 -159-0, OPSD_HUMAN 1-1994, ARRS_MOUSE 2010-2392
Non-standard residues in 5w0p #72
---
NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine;
2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose;
2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE)
5w0p mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
4| author_defined_assembly
25976 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 3 extra chains, 698 C-terminal residues, 8 non-polymer residues more
than 3.0 Angstroms away.
Alignment of 5w0p chain C to query has RMSD 1.33 using 53 of 126 paired
residues within cutoff distance 2.0
1l72 title:
Multiple stabilizing alanine replacements within α-helix 126-134 of T4
lysozyme have independent, additive effects on both structure and stability
[more info...]
Chain information for 1l72 #73
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l72 #73
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l72 chain A to query has RMSD 0.89 using 44 of 125 paired
residues within cutoff distance 2.0
1i6s title:
T4 lysozyme mutant C54T/C97A/N101A [more info...]
Chain information for 1i6s #74
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1i6s #74
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1i6s chain A to query has RMSD 1.04 using 50 of 125 paired
residues within cutoff distance 2.0
1g0p title:
Crystal structure of T4 lysozyme mutant V149G [more info...]
Chain information for 1g0p #75
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1g0p #75
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1g0p chain A to query has RMSD 1.02 using 48 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 167l from http://files.rcsb.org/download/167l.cif
167l title:
Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
[more info...]
Chain information for 167l #76
---
Chain | Description | UniProt
A B | T4 LYSOZYME | LYS_BPT4 1-163
167l mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 28 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 167l chain A to query has RMSD 1.02 using 48 of 125 paired
residues within cutoff distance 2.0
146l title:
Role of backbone flexibility In the accommodation of variants that repack the
core of T4 lysozyme [more info...]
Chain information for 146l #77
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 146l #77
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 146l chain A to query has RMSD 0.981 using 47 of 127 paired
residues within cutoff distance 2.0
5kii title:
Pseudo T4 lysozyme mutant - Y88PHE-methyl [more info...]
Chain information for 5kii #78
---
Chain | Description | UniProt
A | Endolysin | ENLYS_BPT4 1-164
Non-standard residues in 5kii #78
---
HED — 2-hydroxyethyl disulfide
PO4 — phosphate ion
101 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Hit structure sequence 5kii_A amino acid F at sequence position 87 does not
match sequence alignment D at position 85. Structure sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVFDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNLHHHHHH.
Alignment sequence
IFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTF.
Deleted 10 C-terminal residues, 2 N-terminal residues, 186 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 5kii chain A to query has RMSD 1.21 using 25 of 124 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 4yc4 from http://files.rcsb.org/download/4yc4.cif
Fetching CCD M59 from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/9/M59/M59.cif
4yc4 title:
Crystal structure of phosphatidyl inositol 4-kinase II α in complex with
nucleotide analog [more info...]
Chain information for 4yc4 #79
---
Chain | Description | UniProt
A | Phosphatidylinositol 4-kinase type 2-alpha,Lysozyme,Phosphatidylinositol 4-kinase type 2-alpha | P4K2A_HUMAN 76-172 180-468, D9IEF7_BPT4 1004-1166
Non-standard residues in 4yc4 #79
---
ADP — adenosine-5'-diphosphate
M59 — [(1S,3S,4S)-3-(6-amino-9H-purin-9-yl)bicyclo[2.2.1]hept-1-yl]methanol
Deleted 259 C-terminal residues, 73 N-terminal residues, 5 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 4yc4 chain A to query has RMSD 0.805 using 43 of 129 paired
residues within cutoff distance 2.0
3l64 title:
T4 Lysozyme S44E/WT* [more info...]
Chain information for 3l64 #80
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3l64 #80
---
BME — β-mercaptoethanol
Deleted 11 C-terminal residues, 2 N-terminal residues, 37 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3l64 chain A to query has RMSD 0.93 using 45 of 127 paired
residues within cutoff distance 2.0
237l title:
The response of T4 lysozyme to large-to-small substitutions within the core
and its relation to the hydrophobic effect [more info...]
Chain information for 237l #81
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 237l #81
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 11 C-terminal residues, 2 N-terminal residues, 81 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 237l chain A to query has RMSD 1.02 using 49 of 125 paired
residues within cutoff distance 2.0
1l67 title:
Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A
polyalanine α-helix containing ten consecutive alanines [more info...]
Chain information for 1l67 #82
---
Chain | Description | UniProt
A | LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l67 #82
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 7 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l67 chain A to query has RMSD 0.972 using 48 of 127 paired
residues within cutoff distance 2.0
1l53 title:
Structural and thermodynamic analysis of the packing of two α-helices In
bacteriophage T4 lysozyme [more info...]
Chain information for 1l53 #83
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l53 #83
---
BME — β-mercaptoethanol
Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l53 chain A to query has RMSD 0.877 using 44 of 125 paired
residues within cutoff distance 2.0
1l40 title:
Contributions of engineered surface salt bridges to the stability of T4
lysozyme determined by directed mutagenesis [more info...]
Chain information for 1l40 #84
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l40 chain A to query has RMSD 0.936 using 46 of 125 paired
residues within cutoff distance 2.0
1l18 title:
Hydrophobic stabilization In T4 lysozyme determined directly by multiple
substitutions of ile 3 [more info...]
Chain information for 1l18 #85
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l18 chain A to query has RMSD 1.02 using 49 of 125 paired
residues within cutoff distance 2.0
155l title:
Control of enzyme activity by an engineered disulfide bond [more info...]
Chain information for 155l #86
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 155l #86
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 155l chain A to query has RMSD 1.01 using 48 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 152l from http://files.rcsb.org/download/152l.cif
152l title:
Conservation of solvent-binding sites In 10 crystal forms of T4 lysozyme [more
info...]
Chain information for 152l #87
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-163
Non-standard residues in 152l #87
---
SO4 — sulfate ion
Deleted 11 C-terminal residues, 2 N-terminal residues, 22 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 152l chain A to query has RMSD 0.866 using 42 of 127 paired
residues within cutoff distance 2.0
Atom D1 is not in the residue template for MET /A:1
Atom D is not in the residue template for ASN /A:2
Atom D is not in the residue template for ILE /A:3
Atom D is not in the residue template for PHE /A:4
Atom D is not in the residue template for GLU /A:5
Atom D is not in the residue template for ALA /A:6
Atom D is not in the residue template for LEU /A:7
Atom D is not in the residue template for ARG /A:8
Atom D is not in the residue template for ILE /A:9
Too many hydrogens missing from residue template(s) to warn about
6u0e title:
Neutron crystal structure of T4L M6AE [more info...]
Chain information for 6u0e #88
---
Chain | Description | UniProt
A | Endolysin | D9IEF7_BPT4 1-164
664 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues.
Alignment of 6u0e chain A to query has RMSD 1.03 using 48 of 126 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 6u0c from http://files.rcsb.org/download/6u0c.cif
Atom D1 is not in the residue template for MET /A:1
Atom D is not in the residue template for ASN /A:2
Atom D is not in the residue template for ILE /A:3
Atom D is not in the residue template for PHE /A:4
Atom D is not in the residue template for GLU /A:5
Atom D is not in the residue template for MET /A:6
Atom D is not in the residue template for LEU /A:7
Atom D is not in the residue template for ARG /A:8
Atom D is not in the residue template for ILE /A:9
Too many hydrogens missing from residue template(s) to warn about
6u0c title:
Neutron crystal structure of wtT4LE [more info...]
Chain information for 6u0c #89
---
Chain | Description | UniProt
A | Endolysin | D9IEF7_BPT4 1-164
Non-standard residues in 6u0c #89
---
CL — chloride ion
656 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 1 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 6u0c chain A to query has RMSD 0.988 using 48 of 126 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 4djh from http://files.rcsb.org/download/4djh.cif
Fetching CCD JDC from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/C/JDC/JDC.cif
4djh title:
Structure of the human κ opioid receptor in complex with JDTic [more info...]
Chain information for 4djh #90
---
Chain | Description | UniProt
A B | Kappa-type opioid receptor, Lysozyme | OPRK_HUMAN 43-261 263-358, LYS_BPT4 1002-1161
Non-standard residues in 4djh #90
---
CIT — citric acid
JDC —
(3R)-7-hydroxy-N-{(2S)-1-[(3R,4R)-4-(3-hydroxyphenyl)-3,4-dimethylpiperidin-1-yl]-3-methylbutan-2-yl}-1,2,3,4-tetrahydroisoquinoline-3-carboxamide
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
PEG — di(hydroxyethyl)ether
4djh mmCIF Assemblies
---
1| software_defined_assembly
2| software_defined_assembly
6932 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 88 C-terminal residues, 192 N-terminal residues, 29
non-polymer residues more than 3.0 Angstroms away.
Alignment of 4djh chain A to query has RMSD 1.34 using 54 of 141 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 3fa0 from http://files.rcsb.org/download/3fa0.cif
3fa0 title:
Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the
Temperature Sensitive T4 Lysozyme Mutant Arg96-->His [more info...]
Chain information for 3fa0 #91
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-162
Non-standard residues in 3fa0 #91
---
BME — β-mercaptoethanol
CL — chloride ion
HED — 2-hydroxyethyl disulfide
K — potassium ion
PO4 — phosphate ion
37 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
1528 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 9 C-terminal residues, 2 N-terminal residues, 103 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3fa0 chain A to query has RMSD 0.991 using 50 of 125 paired
residues within cutoff distance 2.0
2ray title:
beta-chlorophenetole in complex with T4 lysozyme L99A [more info...]
Chain information for 2ray #92
---
Chain | Description | UniProt
X | Lysozyme | LYS_BPT4 1-162
Non-standard residues in 2ray #92
---
258 — (2-chloroethoxy)benzene
PO4 — phosphate ion
6 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 9 C-terminal residues, 2 N-terminal residues, 93 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 2ray chain X to query has RMSD 0.931 using 48 of 124 paired
residues within cutoff distance 2.0
260l title:
AN adaptable metal-binding site engineered INTO T4 lysozyme [more info...]
Chain information for 260l #93
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 260l #93
---
CL — chloride ion
NI — nickel (II) ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 260l chain A to query has RMSD 0.86 using 43 of 126 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1l86 from http://files.rcsb.org/download/1l86.cif
1l86 title:
Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
lysozyme have different structural and thermodynamic consequences [more
info...]
Chain information for 1l86 #94
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l86 #94
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l86 chain A to query has RMSD 0.866 using 46 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 7z36 from http://files.rcsb.org/download/7z36.cif
7z36 title:
Crystal structure of the KAP1 tripartite motif in complex with the ZNF93 KRAB
domain [more info...]
Chain information for 7z36 #95
---
Chain | Description | UniProt
A B | Endolysin,Transcription intermediary factor 1-beta,Isoform 2 of Transcription intermediary factor 1-beta | ENLYS_BPT4 26-185, TIF1B_HUMAN 187-271, TIF1B-2_HUMAN 272-482
C S | SMARCAD1 CUE1 domain |
D | Zinc finger protein 93 | ZNF93_HUMAN 2-71
Non-standard residues in 7z36 #95
---
ZN — zinc ion
7889 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 4 extra chains, 272 C-terminal residues, 8 non-polymer residues more
than 3.0 Angstroms away.
Alignment of 7z36 chain A to query has RMSD 0.913 using 46 of 134 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 6pgy from http://files.rcsb.org/download/6pgy.cif
6pgy title:
MTSL labelled T4 lysozyme pseudo-wild type K65C mutant [more info...]
Chain information for 6pgy #96
---
Chain | Description | UniProt
A | Endolysin | D9IEF7_BPT4 1-164
Non-standard residues in 6pgy #96
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
methanesulfonothioate (MTSL)
41 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 9 C-terminal residues, 2 N-terminal residues, 32 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 6pgy chain A to query has RMSD 0.98 using 47 of 126 paired
residues within cutoff distance 2.0
254l title:
Lysozyme [more info...]
Chain information for 254l #97
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 254l #97
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 11 C-terminal residues, 2 N-terminal residues, 84 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 254l chain A to query has RMSD 0.98 using 48 of 125 paired
residues within cutoff distance 2.0
213l title:
Protein structure plasticity exemplified by insertion and deletion mutants In
T4 lysozyme [more info...]
Chain information for 213l #98
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 9 C-terminal residues, 2 N-terminal residues, 46 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 213l chain A to query has RMSD 0.987 using 48 of 125 paired
residues within cutoff distance 2.0
1l88 title:
Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
lysozyme have different structural and thermodynamic consequences [more
info...]
Chain information for 1l88 #99
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l88 #99
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l88 chain A to query has RMSD 1.07 using 50 of 125 paired
residues within cutoff distance 2.0
114l title:
Structural basis of α-helix propensity At two sites In T4 lysozyme [more
info...]
Chain information for 114l #100
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 114l #100
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 114l chain A to query has RMSD 1 using 48 of 125 paired residues
within cutoff distance 2.0
102l title:
How amino-acid insertions are allowed In an α-helix of T4 lysozyme [more
info...]
Chain information for 102l #101
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 102l #101
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 102l chain A to query has RMSD 1 using 48 of 125 paired residues
within cutoff distance 2.0
4djh title:
Structure of the human κ opioid receptor in complex with JDTic [more info...]
Chain information for 4djh #102
---
Chain | Description | UniProt
A B | Kappa-type opioid receptor, Lysozyme | OPRK_HUMAN 43-261 263-358, LYS_BPT4 1002-1161
Non-standard residues in 4djh #102
---
CIT — citric acid
JDC —
(3R)-7-hydroxy-N-{(2S)-1-[(3R,4R)-4-(3-hydroxyphenyl)-3,4-dimethylpiperidin-1-yl]-3-methylbutan-2-yl}-1,2,3,4-tetrahydroisoquinoline-3-carboxamide
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
PEG — di(hydroxyethyl)ether
4djh mmCIF Assemblies
---
1| software_defined_assembly
2| software_defined_assembly
6932 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 88 C-terminal residues, 199 N-terminal residues, 30
non-polymer residues more than 3.0 Angstroms away.
Alignment of 4djh chain B to query has RMSD 0.918 using 47 of 134 paired
residues within cutoff distance 2.0
3fad title:
Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the
Temperature Sensitive T4 Lysozyme Mutant Arg96-->His [more info...]
Chain information for 3fad #103
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3fad #103
---
BME — β-mercaptoethanol
PO4 — phosphate ion
3fad mmCIF Assemblies
---
1| author_defined_assembly
2| software_defined_assembly
72 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
1525 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 103 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 3fad chain A to query has RMSD 0.971 using 46 of 122 paired
residues within cutoff distance 2.0
1qt6 title:
E11H Mutant of T4 Lysozyme [more info...]
Chain information for 1qt6 #104
---
Chain | Description | UniProt
A | PROTEIN (T4 LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1qt6 #104
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1qt6 chain A to query has RMSD 1.07 using 50 of 125 paired
residues within cutoff distance 2.0
1qs9 title:
The introduction of strain and its effects on the structure and stability of
T4 lysozyme [more info...]
Chain information for 1qs9 #105
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-162
Deleted 9 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1qs9 chain A to query has RMSD 1.06 using 49 of 125 paired
residues within cutoff distance 2.0
1p36 title:
T4 lyoszyme core repacking mutant I100V/Ta [more info...]
Chain information for 1p36 #106
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1p36 #106
---
BME — β-mercaptoethanol
CL — chloride ion
K — potassium ion
14 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 104 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 1p36 chain A to query has RMSD 0.987 using 50 of 124 paired
residues within cutoff distance 2.0
1l32 title:
Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
protein stability [more info...]
Chain information for 1l32 #107
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l32 chain A to query has RMSD 1.02 using 48 of 127 paired
residues within cutoff distance 2.0
5w0p title:
Crystal structure of rhodopsin bound to visual arrestin determined by X-ray
free electron laser [more info...]
Chain information for 5w0p #108
---
Chain | Description | UniProt
A B C D | Endolysin,Rhodopsin,S-arrestin | A0A097J792_BPT4 -159-0, OPSD_HUMAN 1-1994, ARRS_MOUSE 2010-2392
Non-standard residues in 5w0p #108
---
NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine;
2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose;
2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE)
5w0p mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
4| author_defined_assembly
25976 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 3 extra chains, 697 C-terminal residues, 8 non-polymer residues more
than 3.0 Angstroms away.
Alignment of 5w0p chain A to query has RMSD 0.939 using 41 of 126 paired
residues within cutoff distance 2.0
3cdv title:
Contributions of all 20 amino acids at site 96 to the stability and structure
of T4 lysozyme [more info...]
Chain information for 3cdv #109
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3cdv #109
---
BME — β-mercaptoethanol
CL — chloride ion
38 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3cdv chain A to query has RMSD 1 using 49 of 125 paired residues
within cutoff distance 2.0
201l title:
How amino-acid insertions are allowed In an α-helix of T4 lysozyme [more
info...]
Chain information for 201l #110
---
Chain | Description | UniProt
A B | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 201l #110
---
BME — β-mercaptoethanol
201l mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 94 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 201l chain A to query has RMSD 0.907 using 46 of 125 paired
residues within cutoff distance 2.0
1c6n title:
T4 lysozyme mutant C54T/C97A/L99A/F153A In the presence of 8 atm xenon [more
info...]
Chain information for 1c6n #111
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164
Non-standard residues in 1c6n #111
---
BME — β-mercaptoethanol
CL — chloride ion
XE — XENON
Deleted 10 C-terminal residues, 2 N-terminal residues, 51 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1c6n chain A to query has RMSD 1.01 using 50 of 124 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 5t04 from http://files.rcsb.org/download/5t04.cif
Fetching CCD TCE from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/E/TCE/TCE.cif
5t04 title:
Structure of constitutively active neurotensin receptor [more info...]
Chain information for 5t04 #112
---
Chain | Description | UniProt
A | Neurotensin receptor type 1,Endolysin,Neurotensin receptor type 1 | NTR1_RAT 43-268 297-396, ENLYS_BPT4 1002-1161
B | ARG-ARG-PRO-TYR-ILE-LEU |
Non-standard residues in 5t04 #112
---
GOL — glycerol (glycerin; propane-1,2,3-triol)
PEG — di(hydroxyethyl)ether
TCE — 3,3',3''-phosphanetriyltripropanoic acid
(3-[bis(2-carboxyethyl)phosphanyl]propanoic acid)
3703 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 88 C-terminal residues, 215 N-terminal residues, 4
non-polymer residues more than 3.0 Angstroms away.
Alignment of 5t04 chain A to query has RMSD 1.24 using 57 of 129 paired
residues within cutoff distance 2.0
1g0j title:
Crystal structure of T4 lysozyme mutant T152S [more info...]
Chain information for 1g0j #113
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1g0j #113
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1g0j chain A to query has RMSD 1 using 49 of 125 paired residues
within cutoff distance 2.0
Fetching compressed mmCIF 4pla from http://files.rcsb.org/download/4pla.cif
4pla title:
Crystal structure of phosphatidyl inositol 4-kinase II α in complex with ATP
[more info...]
Chain information for 4pla #114
---
Chain | Description | UniProt
A | Chimera protein of Phosphatidylinositol 4-kinase type 2-alpha and Lysozyme | P4K2A_HUMAN 76-172 180-468, D9IEF7_BPT4 1004-1166
Non-standard residues in 4pla #114
---
ATP — adenosine-5'-triphosphate
Deleted 256 C-terminal residues, 73 N-terminal residues, 3 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 4pla chain A to query has RMSD 0.787 using 42 of 129 paired
residues within cutoff distance 2.0
2ou9 title:
Structure of Spin-labeled T4 Lysozyme Mutant T115R1/R119A [more info...]
Chain information for 2ou9 #115
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 2ou9 #115
---
MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
methanesulfonothioate (MTSL)
Deleted 11 C-terminal residues, 2 N-terminal residues.
Alignment of 2ou9 chain A to query has RMSD 0.947 using 48 of 124 paired
residues within cutoff distance 2.0
1qt3 title:
T26D mutant of T4 lysozyme [more info...]
Chain information for 1qt3 #116
---
Chain | Description | UniProt
A | PROTEIN (T4 Lysozyme) | LYS_BPT4 1-164
Non-standard residues in 1qt3 #116
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 11 C-terminal residues, 2 N-terminal residues, 87 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1qt3 chain A to query has RMSD 1.02 using 49 of 125 paired
residues within cutoff distance 2.0
1qsb title:
The introduction of strain and its effects on the structure and stability of
T4 lysozyme [more info...]
Chain information for 1qsb #117
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162
Non-standard residues in 1qsb #117
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1qsb chain A to query has RMSD 1.03 using 49 of 125 paired
residues within cutoff distance 2.0
1l74 title:
Multiple stabilizing alanine replacements within α-helix 126-134 of T4
lysozyme have independent, additive effects on both structure and stability
[more info...]
Chain information for 1l74 #118
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l74 #118
---
BME — β-mercaptoethanol
CL — chloride ion
5 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l74 chain A to query has RMSD 1.02 using 47 of 125 paired
residues within cutoff distance 2.0
1l01 title:
Structural studies of mutants of the lysozyme of bacteriophage T4. The
temperature-sensitive mutant protein THR157 (right arrow) ile [more info...]
Chain information for 1l01 #119
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l01 chain A to query has RMSD 1.04 using 49 of 124 paired
residues within cutoff distance 2.0
1cv6 title:
T4 lysozyme mutant V149M [more info...]
Chain information for 1cv6 #120
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1cv6 #120
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1cv6 chain A to query has RMSD 1.06 using 50 of 127 paired
residues within cutoff distance 2.0
197l title:
Thermodynamic and structural compensation In "size-switch" core-repacking
variants of T4 lysozyme [more info...]
Chain information for 197l #121
---
Chain | Description | UniProt
A | LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 197l #121
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 42 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 197l chain A to query has RMSD 0.939 using 48 of 127 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 110l from http://files.rcsb.org/download/110l.cif
110l title:
Structural basis of α-helix propensity At two sites In T4 lysozyme [more
info...]
Chain information for 110l #122
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 110l #122
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 110l chain A to query has RMSD 0.928 using 46 of 125 paired
residues within cutoff distance 2.0
2hul title:
Crystal structure of T4 Lysozyme S44C synthetic dimer [more info...]
Chain information for 2hul #123
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 2hul #123
---
GOL — glycerol (glycerin; propane-1,2,3-triol)
SO4 — sulfate ion
2hul mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| software_defined_assembly
24 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 2hul chain A to query has RMSD 0.833 using 45 of 126 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1l55 from http://files.rcsb.org/download/1l55.cif
1l55 title:
Analysis of the interaction between charged side chains and the α-helix dipole
using designed thermostable mutants of phage T4 lysozyme [more info...]
Chain information for 1l55 #124
---
Chain | Description | UniProt
A | LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l55 #124
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l55 chain A to query has RMSD 0.894 using 45 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1d3n from http://files.rcsb.org/download/1d3n.cif
1d3n title:
Methionine core mutation [more info...]
Chain information for 1d3n #125
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1d3n #125
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 49 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1d3n chain A to query has RMSD 0.883 using 44 of 125 paired
residues within cutoff distance 2.0
3c81 title:
Mutant K85A of T4 lysozyme in wildtype background at room temperature [more
info...]
Chain information for 3c81 #126
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3c81 #126
---
BME — β-mercaptoethanol
CL — chloride ion
36 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 47 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3c81 chain A to query has RMSD 0.984 using 47 of 125 paired
residues within cutoff distance 2.0
3c7y title:
Mutant R96A OF T4 lysozyme in wildtype background at 298K [more info...]
Chain information for 3c7y #127
---
Chain | Description | UniProt
A | lysozyme | LYS_BPT4 1-164
Non-standard residues in 3c7y #127
---
BME — β-mercaptoethanol
CL — chloride ion
23 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 21 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3c7y chain A to query has RMSD 0.972 using 47 of 124 paired
residues within cutoff distance 2.0
206l title:
Phage T4 lysozyme [more info...]
Chain information for 206l #128
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 206l #128
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 206l chain A to query has RMSD 1.02 using 49 of 127 paired
residues within cutoff distance 2.0
1pqd title:
T4 lysozyme core repacking mutant CORE10/Ta [more info...]
Chain information for 1pqd #129
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 1pqd #129
---
BME — β-mercaptoethanol
CL — chloride ion
K — potassium ion
11 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 103 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 1pqd chain A to query has RMSD 1.21 using 51 of 124 paired
residues within cutoff distance 2.0
1l48 title:
Structural and thermodynamic analysis of the packing of two α-helices In
bacteriophage T4 lysozyme [more info...]
Chain information for 1l48 #130
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l48 #130
---
BME — β-mercaptoethanol
Deleted 11 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l48 chain A to query has RMSD 1.01 using 47 of 125 paired
residues within cutoff distance 2.0
1jtm title:
Alternative Structures of a Sequence Extended T4 Lysozyme Show that the Highly
Conserved Beta-Sheet has Weak Intrinsic Folding Propensity [more info...]
Chain information for 1jtm #131
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1jtm #131
---
BME — β-mercaptoethanol
Deleted 17 C-terminal residues, 2 N-terminal residues, 1 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1jtm chain A to query has RMSD 1.02 using 50 of 129 paired
residues within cutoff distance 2.0
1cv3 title:
T4 lysozyme mutant L121M [more info...]
Chain information for 1cv3 #132
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1cv3 #132
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1cv3 chain A to query has RMSD 0.997 using 48 of 125 paired
residues within cutoff distance 2.0
147l title:
Role of backbone flexibility In the accommodation of variants that repack the
core of T4 lysozyme [more info...]
Chain information for 147l #133
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 147l #133
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 54 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 147l chain A to query has RMSD 1.04 using 51 of 124 paired
residues within cutoff distance 2.0
7lx8 title:
T4 lysozyme mutant L99A [more info...]
Chain information for 7lx8 #134
---
Chain | Description | UniProt
A | Lysozyme | D9IEF7_BPT4 1-164
Non-standard residues in 7lx8 #134
---
TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer)
YGV — 1-chloro-2-(methylsulfanyl)benzene
27 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 9 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 7lx8 chain A to query has RMSD 0.995 using 47 of 125 paired
residues within cutoff distance 2.0
4w56 title:
T4 Lysozyme L99A with sec-Butylbenzene Bound [more info...]
Chain information for 4w56 #135
---
Chain | Description | UniProt
A | Endolysin | ENLYS_BPT4 1-164
Non-standard residues in 4w56 #135
---
3GY — (2R)-butan-2-ylbenzene (sec-Butylbenzene)
EPE — 4-(2-hydroxyethyl)-1-piperazine ethanesulfonic acid (HEPES)
132 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 47 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 4w56 chain A to query has RMSD 0.904 using 43 of 124 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 3sbb from http://files.rcsb.org/download/3sbb.cif
3sbb title:
Disulphide-mediated Tetramer of T4 Lysozyme R76C/R80C by Synthetic
Symmetrization [more info...]
Chain information for 3sbb #136
---
Chain | Description | UniProt
C | Lysozyme | LYS_BPT4 1-162
Non-standard residues in 3sbb #136
---
CL — chloride ion
3sbb mmCIF Assemblies
---
1| author_and_software_defined_assembly
38 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
1527 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 9 C-terminal residues, 3 N-terminal residues, 117 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3sbb chain C to query has RMSD 1.26 using 61 of 124 paired
residues within cutoff distance 2.0
3c82 title:
Bacteriophage lysozyme T4 lysozyme mutant K85A/R96H [more info...]
Chain information for 3c82 #137
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3c82 #137
---
BME — β-mercaptoethanol
CL — chloride ion
33 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3c82 chain A to query has RMSD 1.02 using 48 of 125 paired
residues within cutoff distance 2.0
1qud title:
L99G mutant of T4 lysozyme [more info...]
Chain information for 1qud #138
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162
Non-standard residues in 1qud #138
---
CL — chloride ion
HEZ — hexane-1,6-diol
Deleted 9 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1qud chain A to query has RMSD 0.961 using 46 of 127 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1p2r from http://files.rcsb.org/download/1p2r.cif
1p2r title:
T4 lysozyme core repacking mutant I78V/Ta [more info...]
Chain information for 1p2r #139
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1p2r #139
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
K — potassium ion
12 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 90 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1p2r chain A to query has RMSD 0.971 using 49 of 127 paired
residues within cutoff distance 2.0
1l97 title:
Structure of A hinge-bending bacteriophage T4 lysozyme mutant, ILE3-> pro
[more info...]
Chain information for 1l97 #140
---
Chain | Description | UniProt
A B | T4 LYSOZYME | LYS_BPT4 1-164
1l97 mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 160
non-polymer residues more than 3.0 Angstroms away.
Alignment of 1l97 chain B to query has RMSD 1.18 using 53 of 122 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1l95 from http://files.rcsb.org/download/1l95.cif
1l95 title:
Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
lysozyme have different structural and thermodynamic consequences [more
info...]
Chain information for 1l95 #141
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l95 #141
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l95 chain A to query has RMSD 0.846 using 45 of 126 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1l85 from http://files.rcsb.org/download/1l85.cif
1l85 title:
Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
lysozyme have different structural and thermodynamic consequences [more
info...]
Chain information for 1l85 #142
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l85 #142
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l85 chain A to query has RMSD 0.902 using 45 of 126 paired
residues within cutoff distance 2.0
1jtn title:
Alternative Structures of a Sequence Extended T4 Lysozyme Show that the Highly
Conserved Beta-Sheet Region has weak intrinsic Folding Propensity [more
info...]
Chain information for 1jtn #143
---
Chain | Description | UniProt
A B | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1jtn #143
---
SO4 — sulfate ion
1jtn mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 1 extra chains, 24 C-terminal residues, 2 N-terminal residues, 112
non-polymer residues more than 3.0 Angstroms away.
Alignment of 1jtn chain A to query has RMSD 0.962 using 47 of 125 paired
residues within cutoff distance 2.0
1g0l title:
Crystal structure of T4 lysozyme mutant T152V [more info...]
Chain information for 1g0l #144
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1g0l #144
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 11 C-terminal residues, 2 N-terminal residues, 91 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1g0l chain A to query has RMSD 1.01 using 49 of 124 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1d9w from http://files.rcsb.org/download/1d9w.cif
1d9w title:
Bacteriophage T4 lysozyme mutant [more info...]
Chain information for 1d9w #145
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1d9w #145
---
BME — β-mercaptoethanol
Deleted 9 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1d9w chain A to query has RMSD 0.959 using 46 of 127 paired
residues within cutoff distance 2.0
1c6i title:
T4 lysozyme mutant C54T/C97A/L99A In the presence of 8 atm argon [more
info...]
Chain information for 1c6i #146
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164
Non-standard residues in 1c6i #146
---
AR — ARGON
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1c6i chain A to query has RMSD 0.998 using 48 of 125 paired
residues within cutoff distance 2.0
125l title:
The energetic cost and the structural consequences of burying A hydroxyl group
within the core of A protein determined from ala to ser and val to THR
substitutions In T4 lysozyme [more info...]
Chain information for 125l #147
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 125l #147
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 125l chain A to query has RMSD 1.04 using 50 of 124 paired
residues within cutoff distance 2.0
108l title:
Structural basis of α-helix propensity At two sites In T4 lysozyme [more
info...]
Chain information for 108l #148
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 108l #148
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 81 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 108l chain A to query has RMSD 0.942 using 47 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 5v86 from http://files.rcsb.org/download/5v86.cif
Fetching CCD 8ZA from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/A/8ZA/8ZA.cif
5v86 title:
Structure of DCN1 bound to NAcM-OPT [more info...]
Chain information for 5v86 #149
---
Chain | Description | UniProt
A | Lysozyme,DCN1-like protein 1 | D9IEF7_BPT4 1-164, DCNL1_HUMAN 1062-1259
Non-standard residues in 5v86 #149
---
8ZA — N-benzyl-N-(1-butylpiperidin-4-yl)-N'-(3,4-dichlorophenyl)urea
48 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
2932 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 196 C-terminal residues, 13 N-terminal residues, 428 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 5v86 chain A to query has RMSD 1.29 using 76 of 124 paired
residues within cutoff distance 2.0
1l93 title:
Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
lysozyme have different structural and thermodynamic consequences [more
info...]
Chain information for 1l93 #150
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l93 #150
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 53 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l93 chain A to query has RMSD 1.08 using 50 of 124 paired
residues within cutoff distance 2.0
1l35 title:
Structure of A thermostable disulfide-bridge mutant of phage T4 lysozyme shows
that an engineered crosslink In A flexible region does not increase the
rigidity of the folded protein [more info...]
Chain information for 1l35 #151
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-163
Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l35 chain A to query has RMSD 1.02 using 49 of 124 paired
residues within cutoff distance 2.0
1cv5 title:
T4 lysozyme mutant L133M [more info...]
Chain information for 1cv5 #152
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1cv5 #152
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 48 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1cv5 chain A to query has RMSD 1.01 using 47 of 125 paired
residues within cutoff distance 2.0
3cdt title:
Contributions of all 20 amino acids at site 96 to the stability and structure
of T4 lysozyme [more info...]
Chain information for 3cdt #153
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3cdt #153
---
BME — β-mercaptoethanol
CL — chloride ion
40 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3cdt chain A to query has RMSD 1 using 49 of 125 paired residues
within cutoff distance 2.0
Fetching compressed mmCIF 3cdo from http://files.rcsb.org/download/3cdo.cif
Fetching CCD MPD from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/D/MPD/MPD.cif
3cdo title:
Bacteriophage T4 lysozyme mutant R96V in wildtype background at low
temperature [more info...]
Chain information for 3cdo #154
---
Chain | Description | UniProt
A B C D | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3cdo #154
---
HEZ — hexane-1,6-diol
MPD — (4S)-2-methyl-2,4-pentanediol
SO4 — sulfate ion
3cdo mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
4| author_defined_assembly
165 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 3 extra chains, 9 C-terminal residues, 2 N-terminal residues, 674 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 3cdo chain A to query has RMSD 1.31 using 59 of 124 paired
residues within cutoff distance 2.0
255l title:
Hydrolase [more info...]
Chain information for 255l #155
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 255l #155
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 11 C-terminal residues, 2 N-terminal residues, 80 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 255l chain A to query has RMSD 1.01 using 49 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1t8f from http://files.rcsb.org/download/1t8f.cif
1t8f title:
Crystal structure of phage T4 lysozyme mutant
R14A/K16A/I17A/K19A/T21A/E22A/C54T/C97A [more info...]
Chain information for 1t8f #156
---
Chain | Description | UniProt
A | Lysozyme | LYCV_BPT4 1-164
Non-standard residues in 1t8f #156
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 37 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1t8f chain A to query has RMSD 0.892 using 46 of 127 paired
residues within cutoff distance 2.0
1llh title:
Are carboxy terminii of helices coded by the local sequence or by tertiary
structure contacts [more info...]
Chain information for 1llh #157
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 1llh #157
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 17 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1llh chain A to query has RMSD 0.985 using 48 of 126 paired
residues within cutoff distance 2.0
1l38 title:
Contributions of engineered surface salt bridges to the stability of T4
lysozyme determined by directed mutagenesis [more info...]
Chain information for 1l38 #158
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l38 chain A to query has RMSD 1.03 using 49 of 125 paired
residues within cutoff distance 2.0
1dyd title:
Determination of α-helix propensity within the context of A folded protein:
sites 44 and 131 In bacteriophage T4 lysozyme [more info...]
Chain information for 1dyd #159
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1dyd #159
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 7 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1dyd chain A to query has RMSD 0.963 using 46 of 127 paired
residues within cutoff distance 2.0
161l title:
Control of enzyme activity by an engineered disulfide bond [more info...]
Chain information for 161l #160
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 161l #160
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 161l chain A to query has RMSD 1.03 using 50 of 126 paired
residues within cutoff distance 2.0
131l title:
Structures of randomly generated mutants of T4 lysozyme show that protein
stability can Be enhanced by relaxation of strain and by improved hydrogen
bonding via bound solvent [more info...]
Chain information for 131l #161
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 131l #161
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 79 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 131l chain A to query has RMSD 0.912 using 46 of 125 paired
residues within cutoff distance 2.0
8jwy title:
Crystal structure of A2AR-T4L in complex with 2-118 [more info...]
Chain information for 8jwy #162
---
Chain | Description | UniProt
A | Adenosine receptor A2a,Endolysin | AA2AR_HUMAN 2-208 369-463, D9IEF7_BPT4 209-368
Non-standard residues in 8jwy #162
---
CLR — cholesterol
NA — sodium ion
OLA — oleic acid
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
VBF —
3-[2-azanyl-6-[2-oxidanylidene-1-[[6-(2-oxidanylpropan-2-yl)pyridin-2-yl]methyl]pyridin-4-yl]pyrimidin-4-yl]-2-methyl-
benzenecarbonitrile
Deleted 97 C-terminal residues, 200 N-terminal residues, 212 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 8jwy chain A to query has RMSD 1.08 using 58 of 126 paired
residues within cutoff distance 2.0
7loc title:
T4 lysozyme mutant L99A in complex with 1-bromanyl-4-fluoranyl-benzene [more
info...]
Chain information for 7loc #163
---
Chain | Description | UniProt
A | Lysozyme | D9IEF7_BPT4 1-164
Non-standard residues in 7loc #163
---
BME — β-mercaptoethanol
TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer)
Y87 — 1-bromanyl-4-fluoranyl-benzene
44 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 10 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 7loc chain A to query has RMSD 0.947 using 45 of 125 paired
residues within cutoff distance 2.0
6zg4 title:
Structure of M1-StaR-T4L in complex with HTL0009936 at 2.35A [more info...]
Chain information for 6zg4 #164
---
Chain | Description | UniProt
A | Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1 | ACM1_HUMAN 27-219 354-438, ENLYS_BPT4 1002-1161
Non-standard residues in 6zg4 #164
---
OLA — oleic acid
PGE — triethylene glycol
PO4 — phosphate ion
QK8 — ethyl
(4~{S})-4-[4-[(1-methylcyclobutyl)carbamoyl]piperidin-1-yl]azepane-1-carboxylate
3556 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 93 C-terminal residues, 200 N-terminal residues, 68 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 6zg4 chain A to query has RMSD 1.04 using 56 of 129 paired
residues within cutoff distance 2.0
5jwu title:
T4 Lysozyme L99A/M102Q with 1,2-Dihydro-1,2-azaborine Bound [more info...]
Chain information for 5jwu #165
---
Chain | Description | UniProt
A | Endolysin | ENLYS_BPT4 1-164
Non-standard residues in 5jwu #165
---
B20 — 1,2-dihydro-1,2-azaborinine (1,2-dihydro-1,2-azaborine)
CL — chloride ion
96 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 8 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 5jwu chain A to query has RMSD 0.952 using 44 of 127 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 4pjz from http://files.rcsb.org/download/4pjz.cif
Fetching CCD 3FG from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/G/3FG/3FG.cif
Fetching CCD 3MY from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/Y/3MY/3MY.cif
Fetching CCD AIB from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/B/AIB/AIB.cif
Fetching CCD DAL from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/L/DAL/DAL.cif
Fetching CCD GCS from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/S/GCS/GCS.cif
Fetching CCD GHP from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/GHP/GHP.cif
Fetching CCD MAN from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/N/MAN/MAN.cif
Fetching CCD OMY from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/Y/OMY/OMY.cif
Fetching CCD T55 from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/5/T55/T55.cif
4pjz title:
Crystal structure of T4 lysozyme-GSS-peptide In complex with teicoplanin-A2-2
[more info...]
Chain information for 4pjz #166
---
Chain | Description | UniProt
A | Lysozyme | D9IEF7_BPT4 1-164
B | TEICOPLANIN-A2-2 |
Non-standard residues in 4pjz #166
---
3FG — (2S)-amino(3,5-dihydroxyphenyl)ethanoic acid
GCS — 2-amino-2-deoxy-beta-D-glucopyranose (beta-D-glucosamine;
2-amino-2-deoxy-beta-D-glucose; 2-amino-2-deoxy-D-glucose; 2-amino-2-deoxy-
glucose; D-GLUCOSAMINE)
GOL — glycerol (glycerin; propane-1,2,3-triol)
MAN — alpha-D-mannopyranose (alpha-D-mannose; D-mannose; mannose)
NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine;
2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose;
2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE)
PO4 — phosphate ion
T55 — 8-methylnonanoic acid
15 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 1 extra chains, 13 C-terminal residues, 2 N-terminal residues, 51 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 4pjz chain A to query has RMSD 0.889 using 45 of 124 paired
residues within cutoff distance 2.0
4exm title:
The crystal structure of an engineered phage lysin containing the binding
domain of pesticin and the killing domain of T4-lysozyme [more info...]
Chain information for 4exm #167
---
Chain | Description | UniProt
A B C D | Pesticin, Lysozyme Chimera | Q57159_YERPE 6-172, LYS_BPT4 173-334
4exm mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
9712 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 3 extra chains, 10 C-terminal residues, 167 N-terminal residues, 70
non-polymer residues more than 3.0 Angstroms away.
Alignment of 4exm chain C to query has RMSD 1.11 using 52 of 127 paired
residues within cutoff distance 2.0
227l title:
Generating ligand binding sites In T4 lysozyme using deficiency-creating
substitutions [more info...]
Chain information for 227l #168
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 227l #168
---
BME — β-mercaptoethanol
BNZ — benzene
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 227l chain A to query has RMSD 1.03 using 49 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1l89 from http://files.rcsb.org/download/1l89.cif
1l89 title:
Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
lysozyme have different structural and thermodynamic consequences [more
info...]
Chain information for 1l89 #169
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l89 #169
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l89 chain A to query has RMSD 1.07 using 51 of 125 paired
residues within cutoff distance 2.0
1dyf title:
Determination of α-helix propensity within the context of A folded protein:
sites 44 and 131 In bacteriophage T4 lysozyme [more info...]
Chain information for 1dyf #170
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1dyf #170
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1dyf chain A to query has RMSD 0.976 using 47 of 127 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 166l from http://files.rcsb.org/download/166l.cif
166l title:
Control of enzyme activity by an engineered disulfide bond [more info...]
Chain information for 166l #171
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 166l #171
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 166l chain A to query has RMSD 1.03 using 49 of 125 paired
residues within cutoff distance 2.0
4w58 title:
T4 Lysozyme L99A with n-Pentylbenzene Bound [more info...]
Chain information for 4w58 #172
---
Chain | Description | UniProt
A | Endolysin | ENLYS_BPT4 1-164
Non-standard residues in 4w58 #172
---
3H2 — pentylbenzene
EPE — 4-(2-hydroxyethyl)-1-piperazine ethanesulfonic acid (HEPES)
161 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 12 C-terminal residues, 2 N-terminal residues, 39 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 4w58 chain A to query has RMSD 0.996 using 46 of 124 paired
residues within cutoff distance 2.0
3c7z title:
T4 lysozyme mutant D89A/R96H at room temperature [more info...]
Chain information for 3c7z #173
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3c7z #173
---
BME — β-mercaptoethanol
CL — chloride ion
29 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 26 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3c7z chain A to query has RMSD 0.984 using 48 of 127 paired
residues within cutoff distance 2.0
1qt7 title:
E11N Mutant of T4 Lysozyme [more info...]
Chain information for 1qt7 #174
---
Chain | Description | UniProt
A | PROTEIN (T4 LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1qt7 #174
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 11 C-terminal residues, 2 N-terminal residues, 86 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1qt7 chain A to query has RMSD 1 using 48 of 125 paired residues
within cutoff distance 2.0
196l title:
Thermodynamic and structural compensation In "size-switch" core-repacking
variants of T4 lysozyme [more info...]
Chain information for 196l #175
---
Chain | Description | UniProt
A | LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 196l #175
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 196l chain A to query has RMSD 1.03 using 49 of 124 paired
residues within cutoff distance 2.0
189l title:
Enhancement of protein stability by the combination of point mutations In T4
lysozyme is additive [more info...]
Chain information for 189l #176
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 24 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 189l chain A to query has RMSD 1.26 using 57 of 127 paired
residues within cutoff distance 2.0
7z36 title:
Crystal structure of the KAP1 tripartite motif in complex with the ZNF93 KRAB
domain [more info...]
Chain information for 7z36 #177
---
Chain | Description | UniProt
A B | Endolysin,Transcription intermediary factor 1-beta,Isoform 2 of Transcription intermediary factor 1-beta | ENLYS_BPT4 26-185, TIF1B_HUMAN 187-271, TIF1B-2_HUMAN 272-482
C S | SMARCAD1 CUE1 domain |
D | Zinc finger protein 93 | ZNF93_HUMAN 2-71
Non-standard residues in 7z36 #177
---
ZN — zinc ion
7889 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 4 extra chains, 284 C-terminal residues, 1 N-terminal residues, 8 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 7z36 chain B to query has RMSD 1.13 using 54 of 135 paired
residues within cutoff distance 2.0
7lx9 title:
T4 lysozyme mutant L99A [more info...]
Chain information for 7lx9 #178
---
Chain | Description | UniProt
A | Lysozyme | D9IEF7_BPT4 1-164
Non-standard residues in 7lx9 #178
---
TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer)
YGM — (but-3-en-1-yl)benzene
5 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 9 C-terminal residues, 2 N-terminal residues, 31 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 7lx9 chain A to query has RMSD 0.917 using 44 of 123 paired
residues within cutoff distance 2.0
5lwo title:
Structure of Spin-labelled T4 lysozyme mutant L115C-R119C-R1 at 100K [more
info...]
Chain information for 5lwo #179
---
Chain | Description | UniProt
A | Endolysin | ENLYS_BPT4 1-164
Non-standard residues in 5lwo #179
---
BME — β-mercaptoethanol
CL — chloride ion
HED — 2-hydroxyethyl disulfide
K — potassium ion
PO4 — phosphate ion
RXR —
[2,2,5,5-tetramethyl-3,4-bis(sulfanylmethyl)-2,5-dihydro-1H-pyrrol-1-yl]oxidanyl
radical (3,4-bis(thiomethyl)-2,2,5,5-tetramethyl-1H-Pyrrol-1-yloxyl radical)
511 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
1340 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 5lwo chain A to query has RMSD 0.973 using 49 of 124 paired
residues within cutoff distance 2.0
4phu title:
Crystal structure of Human GPR40 bound to allosteric agonist TAK-875 [more
info...]
Chain information for 4phu #180
---
Chain | Description | UniProt
A | Free fatty acid receptor 1,Lysozyme | FFAR1_HUMAN 1-211 2214-2300, LYS_BPT4 1002-1161
Non-standard residues in 4phu #180
---
1PE — pentaethylene glycol (PEG400)
2YB —
[(3S)-6-({2',6'-dimethyl-4'-[3-(methylsulfonyl)propoxy]biphenyl-3-yl}methoxy)-2,3-dihydro-1-benzofuran-3-yl]acetic
acid
DMS — dimethyl sulfoxide
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
14 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
3264 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 77 C-terminal residues, 206 N-terminal residues, 77 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 4phu chain A to query has RMSD 0.953 using 47 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 3qak from http://files.rcsb.org/download/3qak.cif
3qak title:
Agonist bound structure of the human adenosine A2a receptor [more info...]
Chain information for 3qak #181
---
Chain | Description | UniProt
A | Adenosine receptor A2a,lysozyme chimera | AA2AR_HUMAN 2-208 222-316, LYS_BPT4 1002-1161
Non-standard residues in 3qak #181
---
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
UKA —
6-(2,2-diphenylethylamino)-9-[(2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxy-
oxolan-2-yl]-N-[2-[(1-pyridin-2-ylpiperidin-4-yl)carbamoylamino]ethyl]purine-2-carboxamide
3480 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 95 C-terminal residues, 198 N-terminal residues, 7 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 3qak chain A to query has RMSD 1.17 using 62 of 125 paired
residues within cutoff distance 2.0
3cdq title:
Contributions of all 20 amino acids at site 96 to the stability and structure
of T4 lysozyme [more info...]
Chain information for 3cdq #182
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3cdq #182
---
BME — β-mercaptoethanol
CL — chloride ion
K — potassium ion
41 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 32 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3cdq chain A to query has RMSD 0.991 using 48 of 125 paired
residues within cutoff distance 2.0
1pqj title:
T4 lysozyme core repacking mutant A111V/CORE10/Ta [more info...]
Chain information for 1pqj #183
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 1pqj #183
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
K — potassium ion
24 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1pqj chain A to query has RMSD 0.926 using 44 of 124 paired
residues within cutoff distance 2.0
1lpy title:
Multiple Methionine Substitutions in T4 Lysozyme [more info...]
Chain information for 1lpy #184
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1lpy #184
---
BME — β-mercaptoethanol
CL — chloride ion
PO4 — phosphate ion
12 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 9 C-terminal residues, 2 N-terminal residues, 45 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1lpy chain A to query has RMSD 1.11 using 50 of 126 paired
residues within cutoff distance 2.0
1l70 title:
Multiple stabilizing alanine replacements within α-helix 126-134 of T4
lysozyme have independent, additive effects on both structure and stability
[more info...]
Chain information for 1l70 #185
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l70 #185
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l70 chain A to query has RMSD 0.942 using 45 of 125 paired
residues within cutoff distance 2.0
1l52 title:
Structural and thermodynamic analysis of the packing of two α-helices In
bacteriophage T4 lysozyme [more info...]
Chain information for 1l52 #186
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l52 chain A to query has RMSD 0.99 using 47 of 125 paired
residues within cutoff distance 2.0
1l43 title:
Cumulative site-directed charge-change replacements In bacteriophage T4
lysozyme suggest that long-range electrostatic interactions contribute little
to protein stability [more info...]
Chain information for 1l43 #187
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l43 chain A to query has RMSD 0.999 using 48 of 126 paired
residues within cutoff distance 2.0
1l22 title:
Contributions of left-handed helical residues to the structure and stability
of bacteriophage T4 lysozyme [more info...]
Chain information for 1l22 #188
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l22 chain A to query has RMSD 1.02 using 48 of 125 paired
residues within cutoff distance 2.0
1l05 title:
Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
phage T4 lysozyme [more info...]
Chain information for 1l05 #189
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l05 chain A to query has RMSD 0.996 using 48 of 125 paired
residues within cutoff distance 2.0
1cu2 title:
T4 lysozyme mutant L84M [more info...]
Chain information for 1cu2 #190
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1cu2 #190
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1cu2 chain A to query has RMSD 0.911 using 46 of 125 paired
residues within cutoff distance 2.0
6iih title:
crystal structure of mitochondrial calcium uptake 2(MICU2) [more info...]
Chain information for 6iih #191
---
Chain | Description | UniProt
A B | Endolysin,Calcium uptake protein 2, mitochondrial | ENLYS_BPT4 1-161, MICU2_HUMAN 164-485
Non-standard residues in 6iih #191
---
CA — calcium ion
Deleted 1 extra chains, 284 C-terminal residues, 2 N-terminal residues, 764
non-polymer residues more than 3.0 Angstroms away.
Alignment of 6iih chain B to query has RMSD 0.929 using 46 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 5cgc from http://files.rcsb.org/download/5cgc.cif
Fetching CCD 51D from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/D/51D/51D.cif
Fetching CCD MES from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/S/MES/MES.cif
5cgc title:
Structure of the human class C GPCR metabotropic glutamate receptor 5
transmembrane domain in complex with the negative allosteric modulator
3-chloro-4-fluoro-5-[6-(1H-pyrazol-1-yl)pyrimidin-4-yl]benzonitrile [more
info...]
Chain information for 5cgc #192
---
Chain | Description | UniProt
A | Metabotropic glutamate receptor 5,Endolysin,Metabotropic glutamate receptor 5 | GRM5_HUMAN 569-678 679-836, ENLYS_BPT4 1002-1161
Non-standard residues in 5cgc #192
---
51D — 3-chloro-4-fluoro-5-[6-(1H-pyrazol-1-yl)pyrimidin-4-yl]benzonitrile
MES — 2-(N-morpholino)-ethanesulfonic acid
OLA — oleic acid
Deleted 146 C-terminal residues, 112 N-terminal residues, 44 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 5cgc chain A to query has RMSD 1.15 using 66 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 4tn3 from http://files.rcsb.org/download/4tn3.cif
4tn3 title:
Structure of the BBox-Coiled-coil region of Rhesus Trim5alpha [more info...]
Chain information for 4tn3 #193
---
Chain | Description | UniProt
A B | TRIM5/cyclophilin A fusion protein/T4 Lysozyme chimera | G9MAP5_MACMU 88-303, ENLYS_BPT4 304-467
Non-standard residues in 4tn3 #193
---
ZN — zinc ion
Deleted 1 extra chains, 11 C-terminal residues, 159 N-terminal residues, 4
non-polymer residues more than 3.0 Angstroms away.
Alignment of 4tn3 chain A to query has RMSD 1.03 using 48 of 160 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 3rze from http://files.rcsb.org/download/3rze.cif
Fetching CCD 5EH from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/H/5EH/5EH.cif
Fetching CCD D7V from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/V/D7V/D7V.cif
3rze title:
Structure of the human histamine H1 receptor in complex with doxepin [more
info...]
Chain information for 3rze #194
---
Chain | Description | UniProt
A | Histamine H1 receptor, Lysozyme chimera | HRH1_HUMAN 20-221 405-487, LYS_BPT4 1002-1161
Non-standard residues in 3rze #194
---
5EH — (3E)-3-(dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-dimethylpropan-1-amine
D7V — (3Z)-3-(dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-dimethylpropan-1-amine
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
PO4 — phosphate ion
42 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
3481 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 89 C-terminal residues, 188 N-terminal residues, 4 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 3rze chain A to query has RMSD 1.09 using 56 of 126 paired
residues within cutoff distance 2.0
3lzm title:
Structural studies of mutants of T4 lysozyme that alter hydrophobic
stabilization [more info...]
Chain information for 3lzm #195
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3lzm chain A to query has RMSD 1.05 using 50 of 125 paired
residues within cutoff distance 2.0
3c7w title:
Contributions of all 20 amino acids at site 96 to the stability and structure
of T4 lysozyme [more info...]
Chain information for 3c7w #196
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3c7w #196
---
BME — β-mercaptoethanol
CL — chloride ion
25 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 36 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3c7w chain A to query has RMSD 0.989 using 48 of 124 paired
residues within cutoff distance 2.0
1p3n title:
Core redesign back-revertant I103V/CORE10 [more info...]
Chain information for 1p3n #197
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1p3n #197
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
K — potassium ion
PO4 — phosphate ion
16 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 99 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1p3n chain A to query has RMSD 0.991 using 48 of 127 paired
residues within cutoff distance 2.0
1l83 title:
A cavity-containing mutant of T4 lysozyme is stabilized by buried benzene
[more info...]
Chain information for 1l83 #198
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l83 #198
---
BME — β-mercaptoethanol
BNZ — benzene
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l83 chain A to query has RMSD 0.952 using 47 of 127 paired
residues within cutoff distance 2.0
1l47 title:
Cumulative site-directed charge-change replacements In bacteriophage T4
lysozyme suggest that long-range electrostatic interactions contribute little
to protein stability [more info...]
Chain information for 1l47 #199
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 10 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l47 chain A to query has RMSD 1 using 49 of 126 paired residues
within cutoff distance 2.0
1l17 title:
Hydrophobic stabilization In T4 lysozyme determined directly by multiple
substitutions of ile 3 [more info...]
Chain information for 1l17 #200
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l17 chain A to query has RMSD 0.985 using 48 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1l16 from http://files.rcsb.org/download/1l16.cif
1l16 title:
Structural analysis of the temperature-sensitive mutant of bacteriophage T4
lysozyme, glycine 156 (right arrow) aspartic acid [more info...]
Chain information for 1l16 #201
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l16 chain A to query has RMSD 1.04 using 50 of 125 paired
residues within cutoff distance 2.0
1l13 title:
Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
phage T4 lysozyme [more info...]
Chain information for 1l13 #202
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 54 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l13 chain A to query has RMSD 1.03 using 49 of 125 paired
residues within cutoff distance 2.0
1l11 title:
Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
phage T4 lysozyme [more info...]
Chain information for 1l11 #203
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l11 #203
---
BME — β-mercaptoethanol
Deleted 11 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l11 chain A to query has RMSD 1.02 using 48 of 125 paired
residues within cutoff distance 2.0
1l06 title:
Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
phage T4 lysozyme [more info...]
Chain information for 1l06 #204
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l06 chain A to query has RMSD 1.03 using 49 of 124 paired
residues within cutoff distance 2.0
1ky0 title:
Methionine core mutant of T4 lysozyme [more info...]
Chain information for 1ky0 #205
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-162
Non-standard residues in 1ky0 #205
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1ky0 chain A to query has RMSD 1.01 using 51 of 126 paired
residues within cutoff distance 2.0
1c6a title:
T4 lysozyme mutant C54T/C97A/L133A In the presence of 8 atm krypton [more
info...]
Chain information for 1c6a #206
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1c6a #206
---
BME — β-mercaptoethanol
CL — chloride ion
KR — krypton
Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1c6a chain A to query has RMSD 1.05 using 49 of 125 paired
residues within cutoff distance 2.0
158l title:
Control of enzyme activity by an engineered disulfide bond [more info...]
Chain information for 158l #207
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 158l #207
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 158l chain A to query has RMSD 1.03 using 49 of 125 paired
residues within cutoff distance 2.0
126l title:
The energetic cost and the structural consequences of burying A hydroxyl group
within the core of A protein determined from ala to ser and val to THR
substitutions In T4 lysozyme [more info...]
Chain information for 126l #208
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 126l #208
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 126l chain A to query has RMSD 1.03 using 49 of 125 paired
residues within cutoff distance 2.0
120l title:
The energetic cost and the structural consequences of burying A hydroxyl group
within the core of A protein determined from ala to ser and val to THR
substitutions In T4 lysozyme [more info...]
Chain information for 120l #209
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 120l #209
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 84 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 120l chain A to query has RMSD 1.03 using 50 of 125 paired
residues within cutoff distance 2.0
118l title:
The energetic cost and the structural consequences of burying A hydroxyl group
within the core of A protein determined from ala to ser and val to THR
substitutions In T4 lysozyme [more info...]
Chain information for 118l #210
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 118l #210
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 118l chain A to query has RMSD 0.996 using 48 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 8jwz from http://files.rcsb.org/download/8jwz.cif
Fetching CCD U30 from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/0/U30/U30.cif
8jwz title:
Crystal structure of A2AR-T4L in complex with AB928 [more info...]
Chain information for 8jwz #211
---
Chain | Description | UniProt
A | Adenosine receptor A2a,Endolysin | AA2AR_HUMAN 2-208 369-463, D9IEF7_BPT4 209-368
Non-standard residues in 8jwz #211
---
CLR — cholesterol
NA — sodium ion
OLA — oleic acid
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
PEG — di(hydroxyethyl)ether
U30 —
3-[2-azanyl-6-[1-[[6-(2-oxidanylpropan-2-yl)pyridin-2-yl]methyl]-1,2,3-triazol-4-yl]pyrimidin-4-yl]-2-methyl-
benzenecarbonitrile
Deleted 97 C-terminal residues, 202 N-terminal residues, 254 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 8jwz chain A to query has RMSD 1.09 using 58 of 126 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 5dgy from http://files.rcsb.org/download/5dgy.cif
5dgy title:
Crystal structure of rhodopsin bound to visual arrestin [more info...]
Chain information for 5dgy #212
---
Chain | Description | UniProt
A B C D | Endolysin,Rhodopsin,S-arrestin | ENLYS_BPT4 -159-0, OPSD_HUMAN 1-994, ARRS_MOUSE 1010-1392
5dgy mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
24665 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 3 extra chains, 681 C-terminal residues, 1 N-terminal residues.
Alignment of 5dgy chain A to query has RMSD 1.23 using 61 of 125 paired
residues within cutoff distance 2.0
3hwl title:
Crystal Structure of T4 lysozyme with the unnatural amino acid p-Acetyl-L-
Phenylalanine incorporated at position 131 [more info...]
Chain information for 3hwl #213
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3hwl #213
---
AZI — azide ion
CL — chloride ion
3hwl mmCIF Assemblies
---
1| software_defined_assembly
6 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
1431 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Hit structure sequence 3hwl_A amino acid F at sequence position 130 does not
match sequence alignment N at position 128. Structure sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAFNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL.
Alignment sequence
IFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAANLAKSRWYNQTPNRAKRVITTF.
Deleted 10 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3hwl chain A to query has RMSD 0.82 using 37 of 125 paired
residues within cutoff distance 2.0
239l title:
The response of T4 lysozyme to large-to-small substitutions within the core
and its relation to the hydrophobic effect [more info...]
Chain information for 239l #214
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 239l #214
---
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 239l chain A to query has RMSD 0.956 using 47 of 126 paired
residues within cutoff distance 2.0
229l title:
Generating ligand binding sites In T4 lysozyme using deficiency-creating
substitutions [more info...]
Chain information for 229l #215
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 229l #215
---
BME — β-mercaptoethanol
CL — chloride ion
GAI — guanidine
Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 229l chain A to query has RMSD 1.03 using 51 of 125 paired
residues within cutoff distance 2.0
211l title:
Protein structure plasticity exemplified by insertion and deletion mutants In
T4 lysozyme [more info...]
Chain information for 211l #216
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 211l #216
---
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 211l chain A to query has RMSD 0.989 using 47 of 125 paired
residues within cutoff distance 2.0
1qtb title:
The introduction of strain and its effects on the structure and stability of
T4 lysozyme [more info...]
Chain information for 1qtb #217
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-162
Non-standard residues in 1qtb #217
---
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1qtb chain A to query has RMSD 1.02 using 49 of 126 paired
residues within cutoff distance 2.0
1pqo title:
T4 Lysozyme Core Repacking Mutant L118I/TA [more info...]
Chain information for 1pqo #218
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 1pqo #218
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
K — potassium ion
10 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1pqo chain A to query has RMSD 0.949 using 48 of 127 paired
residues within cutoff distance 2.0
1l44 title:
Cumulative site-directed charge-change replacements In bacteriophage T4
lysozyme suggest that long-range electrostatic interactions contribute little
to protein stability [more info...]
Chain information for 1l44 #219
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l44 chain A to query has RMSD 0.943 using 46 of 125 paired
residues within cutoff distance 2.0
1l28 title:
Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
protein stability [more info...]
Chain information for 1l28 #220
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l28 chain A to query has RMSD 1.06 using 50 of 127 paired
residues within cutoff distance 2.0
1l02 title:
Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
phage T4 lysozyme [more info...]
Chain information for 1l02 #221
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l02 chain A to query has RMSD 1.04 using 50 of 127 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1l00 from http://files.rcsb.org/download/1l00.cif
1l00 title:
Perturbation of TRP 138 In T4 lysozyme by mutations At GLN 105 used to
correlate changes In structure, stability, solvation, and spectroscopic
properties [more info...]
Chain information for 1l00 #222
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l00 #222
---
BME — β-mercaptoethanol
Deleted 9 C-terminal residues, 2 N-terminal residues, 78 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l00 chain A to query has RMSD 0.995 using 46 of 127 paired
residues within cutoff distance 2.0
1g07 title:
Crystal structure of T4 lysozyme mutant V149C [more info...]
Chain information for 1g07 #223
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1g07 #223
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
1 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 9 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1g07 chain A to query has RMSD 1.01 using 49 of 125 paired
residues within cutoff distance 2.0
199l title:
Thermodynamic and structural compensation In "size-switch" core-repacking
variants of T4 lysozyme [more info...]
Chain information for 199l #224
---
Chain | Description | UniProt
A | LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 199l #224
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 199l chain A to query has RMSD 1.03 using 51 of 124 paired
residues within cutoff distance 2.0
195l title:
Thermodynamic and structural compensation In "size-switch" core-repacking
variants of T4 lysozyme [more info...]
Chain information for 195l #225
---
Chain | Description | UniProt
A | LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 195l #225
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 195l chain A to query has RMSD 0.95 using 48 of 127 paired
residues within cutoff distance 2.0
7p41 title:
Crystal Structure of human mARC1 A165T Variant [more info...]
Chain information for 7p41 #226
---
Chain | Description | UniProt
D | Mitochondrial amidoxime-reducing component 1,Endolysin,Mitochondrial amidoxime-reducing component 1 | MARC1_HUMAN 53-128 288-495, D9IEF7_BPT4 129-287
Non-standard residues in 7p41 #226
---
B3P — 2-[3-(2-hydroxy-1,1-dihydroxymethyl-
ethylamino)-propylamino]-2-hydroxymethyl-propane-1,3-diol
CL — chloride ion
EFK — oxidanyl(oxidanylidene)molybdenum
MTE — phosphonic
acidmono-(2-amino-5,6-dimercapto-4-oxo-3,7,8A,9,10,10A-hexahydro-4H-8-oxa-1,3,9,10-tetraaza-
anthracen-7-ylmethyl)ester
63 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 214 C-terminal residues, 79 N-terminal residues, 402 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 7p41 chain D to query has RMSD 0.947 using 48 of 125 paired
residues within cutoff distance 2.0
7lxa title:
T4 lysozyme mutant L99A [more info...]
Chain information for 7lxa #227
---
Chain | Description | UniProt
A | Lysozyme | D9IEF7_BPT4 1-164
Non-standard residues in 7lxa #227
---
BME — β-mercaptoethanol
TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer)
YGS — (2-methylprop-2-en-1-yl)benzene
9 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 9 C-terminal residues, 1 N-terminal residues, 34 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 7lxa chain A to query has RMSD 0.922 using 44 of 122 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 6luq from http://files.rcsb.org/download/6luq.cif
Fetching CCD GMJ from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/J/GMJ/GMJ.cif
6luq title:
Haloperidol bound D2 dopamine receptor structure inspired discovery of subtype
selective ligands [more info...]
Chain information for 6luq #228
---
Chain | Description | UniProt
A | chimera of D(2) dopamine receptor and Endolysin | DRD2_HUMAN 35-222 388-464, D9IEF7_BPT4
Non-standard residues in 6luq #228
---
GMJ —
4-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one
OLA — oleic acid
Deleted 85 C-terminal residues, 184 N-terminal residues, 12 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 6luq chain A to query has RMSD 1.03 using 54 of 126 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 3sb5 from http://files.rcsb.org/download/3sb5.cif
3sb5 title:
Zn-mediated Trimer of T4 Lysozyme R125C/E128C by Synthetic Symmetrization
[more info...]
Chain information for 3sb5 #229
---
Chain | Description | UniProt
A B C D | Lysozyme | LYS_BPT4 1-162
Non-standard residues in 3sb5 #229
---
CL — chloride ion
GOL — glycerol (glycerin; propane-1,2,3-triol)
MG — magnesium ion
ZN — zinc ion
3sb5 mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
3| author_and_software_defined_assembly
4| author_and_software_defined_assembly
8 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
5326 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 3 extra chains, 9 C-terminal residues, 4 N-terminal residues, 191 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 3sb5 chain A to query has RMSD 1.17 using 68 of 125 paired
residues within cutoff distance 2.0
3jr6 title:
Sequential reorganization of beta-sheet topology by insertion of a single
strand [more info...]
Chain information for 3jr6 #230
---
Chain | Description | UniProt
A B C D | Lysozyme | LYS_BPT4 1-170
Non-standard residues in 3jr6 #230
---
SO4 — sulfate ion
3jr6 mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
4| author_defined_assembly
Deleted 3 extra chains, 10 C-terminal residues, 2 N-terminal residues, 6 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 3jr6 chain B to query has RMSD 1.16 using 60 of 123 paired
residues within cutoff distance 2.0
3cdr title:
R96Q Mutant of wildtype phage T4 lysozyme at 298 K [more info...]
Chain information for 3cdr #231
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3cdr #231
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
31 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 40 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3cdr chain A to query has RMSD 0.992 using 48 of 125 paired
residues within cutoff distance 2.0
3c8q title:
Contribution of all 20 amino acids at site 96 to the stability and structure
of T4 lysozyme [more info...]
Chain information for 3c8q #232
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3c8q #232
---
BME — β-mercaptoethanol
CL — chloride ion
K — potassium ion
41 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 29 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3c8q chain A to query has RMSD 0.954 using 47 of 125 paired
residues within cutoff distance 2.0
233l title:
T4 lysozyme mutant M120L [more info...]
Chain information for 233l #233
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 233l #233
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 233l chain A to query has RMSD 0.947 using 46 of 125 paired
residues within cutoff distance 2.0
1ov7 title:
T4 Lysozyme Cavity Mutant L99A/M102Q Bound with 2-Allyl-6-Methyl-Phenol [more
info...]
Chain information for 1ov7 #234
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 1ov7 #234
---
BME — β-mercaptoethanol
CL — chloride ion
LYL — 2-allyl-6-methyl-phenol
Deleted 9 C-terminal residues, 2 N-terminal residues, 22 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1ov7 chain A to query has RMSD 0.956 using 46 of 125 paired
residues within cutoff distance 2.0
1lyf title:
Dissection of helix capping In T4 lysozyme by structural and thermodynamic
analysis of six amino acid substitutions At THR 59 [more info...]
Chain information for 1lyf #235
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1lyf #235
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 7 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1lyf chain A to query has RMSD 0.934 using 46 of 127 paired
residues within cutoff distance 2.0
1l81 title:
Design and structural analysis of alternative hydrophobic core packing
arrangements In bacteriophage T4 lysozyme [more info...]
Chain information for 1l81 #236
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l81 #236
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l81 chain A to query has RMSD 1.12 using 53 of 124 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1l54 from http://files.rcsb.org/download/1l54.cif
1l54 title:
The structural and thermodynamic consequences of burying A charged residue
within the hydrophobic core of T4 lysozyme [more info...]
Chain information for 1l54 #237
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l54 chain A to query has RMSD 0.936 using 46 of 125 paired
residues within cutoff distance 2.0
1l50 title:
Structural and thermodynamic analysis of the packing of two α-helices In
bacteriophage T4 lysozyme [more info...]
Chain information for 1l50 #238
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l50 chain A to query has RMSD 1.03 using 48 of 127 paired
residues within cutoff distance 2.0
1l23 title:
Enhanced protein thermostability from site-directed mutations that decrease
the entropy of unfolding [more info...]
Chain information for 1l23 #239
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l23 chain A to query has RMSD 1.03 using 49 of 125 paired
residues within cutoff distance 2.0
1l19 title:
Enhanced protein thermostability from designed mutations that interact with
α-helix dipoles [more info...]
Chain information for 1l19 #240
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l19 chain A to query has RMSD 1.04 using 49 of 125 paired
residues within cutoff distance 2.0
1jqu title:
Are Carboxy Terminii of Helices Coded by the Local Sequence or by Tertiary
Structure Contacts [more info...]
Chain information for 1jqu #241
---
Chain | Description | UniProt
A B C D | Lysozyme | LYS_BPT4 1-164
1jqu mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
4| author_defined_assembly
Deleted 3 extra chains, 11 C-terminal residues, 2 N-terminal residues, 28 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 1jqu chain D to query has RMSD 1.24 using 52 of 121 paired
residues within cutoff distance 2.0
1d2y title:
N-terminal domain core methionine mutation [more info...]
Chain information for 1d2y #242
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1d2y #242
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1d2y chain A to query has RMSD 0.962 using 47 of 125 paired
residues within cutoff distance 2.0
1cu6 title:
T4 lysozyme mutant L91A [more info...]
Chain information for 1cu6 #243
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1cu6 #243
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1cu6 chain A to query has RMSD 0.97 using 47 of 127 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1b6i from http://files.rcsb.org/download/1b6i.cif
1b6i title:
T4 lysozyme mutant with cys 54 replaced by THR, cys 97 replaced by ala, THR 21
replaced by cys and lys 124 replaced by cys (C54T,C97A,T21C,K124C) [more
info...]
Chain information for 1b6i #244
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1b6i #244
---
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 33 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1b6i chain A to query has RMSD 0.986 using 47 of 125 paired
residues within cutoff distance 2.0
138l title:
Rapid crystallization of T4 lysozyme by intermolecular disulfide crosslinking
[more info...]
Chain information for 138l #245
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 138l #245
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 50 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 138l chain A to query has RMSD 0.981 using 48 of 125 paired
residues within cutoff distance 2.0
130l title:
Structures of randomly generated mutants of T4 lysozyme show that protein
stability can Be enhanced by relaxation of strain and by improved hydrogen
bonding via bound solvent [more info...]
Chain information for 130l #246
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 130l #246
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 87 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 130l chain A to query has RMSD 0.931 using 46 of 125 paired
residues within cutoff distance 2.0
Atom OE1 has no neighbors to form bonds with according to residue template for
GLN /A:-3
Atom NE2 has no neighbors to form bonds with according to residue template for
GLN /A:-3
6xom title:
DCN1 bound to 8 [more info...]
Chain information for 6xom #247
---
Chain | Description | UniProt
A | Lysozyme, DCN1-like protein 1 chimera | D9IEF7_BPT4 1-164, DCNL1_HUMAN 1062-1259
Non-standard residues in 6xom #247
---
EDO — 1,2-ethanediol (ethylene glycol)
H8V —
(2R)-N-[(2S)-2-cyclohexyl-2-({N-propanoyl-3-[6-(propan-2-yl)-1,3-benzothiazol-2-yl]-L-alanyl}amino)ethyl]-2-methyl-4-(morpholin-4-yl)butanamide
14 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
2837 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 201 C-terminal residues, 4 N-terminal residues, 207 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 6xom chain A to query has RMSD 0.983 using 52 of 126 paired
residues within cutoff distance 2.0
5d5a title:
In meso in situ serial X-ray crystallography structure of the Beta2-adrenergic
receptor at 100 K [more info...]
Chain information for 5d5a #248
---
Chain | Description | UniProt
A | Beta-2 adrenergic receptor,Endolysin,Beta-2 adrenergic receptor | ADRB2_HUMAN 1-230 263-365, ENLYS_BPT4 1002-1161
Non-standard residues in 5d5a #248
---
12P — dodecaethylene glycol (polyethylene glycol PEG400)
ACM — acetamide
BGC — beta-D-glucopyranose (beta-D-glucose; D-glucose; glucose)
BU1 — 1,4-butanediol
CAU — (2S)-1-(9H-Carbazol-4-yloxy)-3-(isopropylamino)propan-2-ol
((S)-Carazolol)
CLR — cholesterol
GLC — alpha-D-glucopyranose (alpha-D-glucose; D-glucose; glucose)
PLM — palmitic acid
SO4 — sulfate ion
Deleted 88 C-terminal residues, 197 N-terminal residues, 35 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 5d5a chain A to query has RMSD 1.04 using 49 of 132 paired
residues within cutoff distance 2.0
4lzm title:
Comparison of the crystal structure of bacteriophage T4 lysozyme At low,
medium, and high ionic strengths [more info...]
Chain information for 4lzm #249
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 4lzm #249
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 4lzm chain A to query has RMSD 1.02 using 49 of 125 paired
residues within cutoff distance 2.0
3htb title:
2-propylphenol in complex with T4 lysozyme L99A/M102Q [more info...]
Chain information for 3htb #250
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3htb #250
---
BME — β-mercaptoethanol
JZ4 — 2-propylphenol
PO4 — phosphate ion
64 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 10 C-terminal residues, 2 N-terminal residues, 97 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3htb chain A to query has RMSD 0.981 using 47 of 123 paired
residues within cutoff distance 2.0
1quh title:
L99G/E108V mutant of T4 lysozyme [more info...]
Chain information for 1quh #251
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162
Non-standard residues in 1quh #251
---
CL — chloride ion
HEZ — hexane-1,6-diol
Deleted 9 C-terminal residues, 2 N-terminal residues, 46 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1quh chain A to query has RMSD 0.994 using 49 of 127 paired
residues within cutoff distance 2.0
1qt5 title:
D20E mutant structure of T4 lysozyme [more info...]
Chain information for 1qt5 #252
---
Chain | Description | UniProt
A | PROTEIN (T4 LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1qt5 #252
---
HED — 2-hydroxyethyl disulfide
Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1qt5 chain A to query has RMSD 1 using 48 of 125 paired residues
within cutoff distance 2.0
1l64 title:
Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A
polyalanine α-helix containing ten consecutive alanines [more info...]
Chain information for 1l64 #253
---
Chain | Description | UniProt
A | LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l64 #253
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l64 chain A to query has RMSD 0.937 using 46 of 124 paired
residues within cutoff distance 2.0
1l58 title:
Analysis of the interaction between charged side chains and the α-helix dipole
using designed thermostable mutants of phage T4 lysozyme [more info...]
Chain information for 1l58 #254
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l58 #254
---
BME — β-mercaptoethanol
Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l58 chain A to query has RMSD 0.963 using 47 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1l34 from http://files.rcsb.org/download/1l34.cif
1l34 title:
High-resolution structure of the temperature-sensitive mutant of phage
lysozyme, arg 96 (right arrow) his [more info...]
Chain information for 1l34 #255
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l34 chain A to query has RMSD 1.02 using 48 of 125 paired
residues within cutoff distance 2.0
1kw7 title:
Methionine core mutant of T4 lysozyme [more info...]
Chain information for 1kw7 #256
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-162
Non-standard residues in 1kw7 #256
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1kw7 chain A to query has RMSD 0.975 using 46 of 125 paired
residues within cutoff distance 2.0
1cu5 title:
T4 lysozyme mutant L91M [more info...]
Chain information for 1cu5 #257
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1cu5 #257
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1cu5 chain A to query has RMSD 0.988 using 48 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 6igl from http://files.rcsb.org/download/6igl.cif
Fetching CCD SIN from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/N/SIN/SIN.cif
6igl title:
Crystal Structure of human ETB receptor in complex with IRL1620 [more info...]
Chain information for 6igl #258
---
Chain | Description | UniProt
A | Endothelin receptor type B,Endolysin,Endothelin receptor type B | EDNRB_HUMAN 66-303 311-407, A0A097J809_BPT4 1000-1159
B | IRL1620 |
Non-standard residues in 6igl #258
---
CIT — citric acid
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
SIN — succinic acid
SO4 — sulfate ion
8 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 1 extra chains, 100 C-terminal residues, 215 N-terminal residues, 31
non-polymer residues more than 3.0 Angstroms away.
Alignment of 6igl chain A to query has RMSD 1.03 using 54 of 126 paired
residues within cutoff distance 2.0
6bg5 title:
Structure of
1-(benzo[d][1,3]dioxol-5-ylmethyl)-1-(1-propylpiperidin-4-yl)-3-(3-(trifluoromethyl)phenyl)urea
bound to DCN1 [more info...]
Chain information for 6bg5 #259
---
Chain | Description | UniProt
A | Endolysin, DCN1-like protein 1 chimera | ENLYS_BPT4 1-164, DCNL1_HUMAN 1062-1259
Non-standard residues in 6bg5 #259
---
DQD —
N-[(2H-1,3-benzodioxol-5-yl)methyl]-N-(1-propylpiperidin-4-yl)-N'-[3-(trifluoromethyl)phenyl]urea
158 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
3553 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 200 C-terminal residues, 15 N-terminal residues, 480 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 6bg5 chain A to query has RMSD 1.26 using 67 of 121 paired
residues within cutoff distance 2.0
243l title:
The response of T4 lysozyme to large-to-small substitutions within the core
and its relation to the hydrophobic effect [more info...]
Chain information for 243l #260
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 243l #260
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 243l chain A to query has RMSD 0.981 using 47 of 125 paired
residues within cutoff distance 2.0
226l title:
Generating ligand binding sites In T4 lysozyme using deficiency-creating
substitutions [more info...]
Chain information for 226l #261
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 226l #261
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 226l chain A to query has RMSD 0.942 using 45 of 126 paired
residues within cutoff distance 2.0
1qsq title:
Cavity creating mutation [more info...]
Chain information for 1qsq #262
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1qsq #262
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1qsq chain A to query has RMSD 0.989 using 48 of 125 paired
residues within cutoff distance 2.0
1p7s title:
T4 lysozyme core repacking mutant V103I/Ta [more info...]
Chain information for 1p7s #263
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
11 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 83 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1p7s chain A to query has RMSD 1.3 using 60 of 124 paired
residues within cutoff distance 2.0
1l98 title:
Perturbation of TRP 138 In T4 lysozyme by mutations At GLN 105 used to
correlate changes In structure, stability, solvation, and spectroscopic
properties [more info...]
Chain information for 1l98 #264
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l98 #264
---
BME — β-mercaptoethanol
Deleted 11 C-terminal residues, 2 N-terminal residues, 88 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l98 chain A to query has RMSD 0.955 using 46 of 127 paired
residues within cutoff distance 2.0
1l80 title:
Design and structural analysis of alternative hydrophobic core packing
arrangements In bacteriophage T4 lysozyme [more info...]
Chain information for 1l80 #265
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l80 #265
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l80 chain A to query has RMSD 0.926 using 45 of 125 paired
residues within cutoff distance 2.0
1l41 title:
Contributions of engineered surface salt bridges to the stability of T4
lysozyme determined by directed mutagenesis [more info...]
Chain information for 1l41 #266
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l41 chain A to query has RMSD 0.965 using 47 of 125 paired
residues within cutoff distance 2.0
1l30 title:
Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
protein stability [more info...]
Chain information for 1l30 #267
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l30 chain A to query has RMSD 1.02 using 48 of 125 paired
residues within cutoff distance 2.0
1g1v title:
T4 lysozyme mutant C54T/C97A/I58T [more info...]
Chain information for 1g1v #268
---
Chain | Description | UniProt
A | LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1g1v #268
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1g1v chain A to query has RMSD 0.909 using 45 of 125 paired
residues within cutoff distance 2.0
191l title:
A helix initiation signal In T4 lysozyme identified by polyalanine mutagenesis
[more info...]
Chain information for 191l #269
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 191l #269
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 191l chain A to query has RMSD 1.05 using 49 of 127 paired
residues within cutoff distance 2.0
190l title:
A helix initiation signal In T4 lysozyme identified by polyalanine mutagenesis
[more info...]
Chain information for 190l #270
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 190l #270
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 190l chain A to query has RMSD 0.973 using 46 of 127 paired
residues within cutoff distance 2.0
2huk title:
Crystal structure of T4 Lysozyme V131C synthetic dimer [more info...]
Chain information for 2huk #271
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 2huk #271
---
SO4 — sulfate ion
2huk mmCIF Assemblies
---
1| author_defined_assembly
9 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 33 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 2huk chain A to query has RMSD 1.04 using 54 of 127 paired
residues within cutoff distance 2.0
236l title:
The response of T4 lysozyme to large-to-small substitutions within the core
and its relation to the hydrophobic effect [more info...]
Chain information for 236l #272
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 236l #272
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 236l chain A to query has RMSD 1.03 using 50 of 127 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1ovk from http://files.rcsb.org/download/1ovk.cif
Fetching CCD NYL from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/L/NYL/NYL.cif
1ovk title:
T4 Lysozyme Cavity Mutant L99A/M102Q Bound with N-Allyl-Aniline [more info...]
Chain information for 1ovk #273
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 1ovk #273
---
BME — β-mercaptoethanol
CL — chloride ion
NYL — N-allyl-aniline
Deleted 9 C-terminal residues, 2 N-terminal residues, 25 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1ovk chain A to query has RMSD 0.99 using 48 of 124 paired
residues within cutoff distance 2.0
1c6t title:
T4 lysozyme mutant C54T/C97A In the presence of 8 atm xenon [more info...]
Chain information for 1c6t #274
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164
Non-standard residues in 1c6t #274
---
BME — β-mercaptoethanol
CL — chloride ion
XE — XENON
Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1c6t chain A to query has RMSD 0.981 using 49 of 125 paired
residues within cutoff distance 2.0
160l title:
Control of enzyme activity by an engineered disulfide bond [more info...]
Chain information for 160l #275
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 160l #275
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 160l chain A to query has RMSD 0.997 using 48 of 125 paired
residues within cutoff distance 2.0
139l title:
Rapid crystallization of T4 lysozyme by intermolecular disulfide crosslinking
[more info...]
Chain information for 139l #276
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 139l #276
---
BME — β-mercaptoethanol
CL — chloride ion
139l mmCIF Assemblies
---
1| author_defined_assembly
2| software_defined_assembly
Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 139l chain A to query has RMSD 0.976 using 48 of 125 paired
residues within cutoff distance 2.0
123l title:
The energetic cost and the structural consequences of burying A hydroxyl group
within the core of A protein determined from ala to ser and val to THR
substitutions In T4 lysozyme [more info...]
Chain information for 123l #277
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 123l #277
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 123l chain A to query has RMSD 0.999 using 48 of 125 paired
residues within cutoff distance 2.0
5wf6 title:
Agonist bound human A2a adenosine receptor with S91A mutation at 2.90 A
resolution [more info...]
Chain information for 5wf6 #278
---
Chain | Description | UniProt
A | Human A2a adenosine receptor T4L chimera | AA2AR_HUMAN 2-208 222-316, ENLYS_BPT4 1002-1161
Non-standard residues in 5wf6 #278
---
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
UKA —
6-(2,2-diphenylethylamino)-9-[(2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxy-
oxolan-2-yl]-N-[2-[(1-pyridin-2-ylpiperidin-4-yl)carbamoylamino]ethyl]purine-2-carboxamide
Deleted 94 C-terminal residues, 184 N-terminal residues, 4 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 5wf6 chain A to query has RMSD 1.15 using 62 of 136 paired
residues within cutoff distance 2.0
249l title:
The response of T4 lysozyme to large-to-small substitutions within the core
and its relation to the hydrophobic effect [more info...]
Chain information for 249l #279
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 249l #279
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 249l chain A to query has RMSD 0.968 using 47 of 125 paired
residues within cutoff distance 2.0
235l title:
The response of T4 lysozyme to large-to-small substitutions within the core
and its relation to the hydrophobic effect [more info...]
Chain information for 235l #280
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 235l #280
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 235l chain A to query has RMSD 1.01 using 48 of 125 paired
residues within cutoff distance 2.0
1ssy title:
Crystal structure of phage T4 lysozyme mutant G28A/I29A/G30A/C54T/C97A [more
info...]
Chain information for 1ssy #281
---
Chain | Description | UniProt
A B | Lysozyme | LYS_BPT4 1-164
1ssy mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 57 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 1ssy chain B to query has RMSD 0.901 using 45 of 125 paired
residues within cutoff distance 2.0
1nhb title:
Specificity of ligand binding in a buried non-polar cavity of t4 lysozyme:
linkage of dynamics and structural plasticity [more info...]
Chain information for 1nhb #282
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1nhb #282
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
PYJ — phenylethane
Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1nhb chain A to query has RMSD 0.982 using 49 of 127 paired
residues within cutoff distance 2.0
1l49 title:
Structural and thermodynamic analysis of the packing of two α-helices In
bacteriophage T4 lysozyme [more info...]
Chain information for 1l49 #283
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l49 chain A to query has RMSD 1.1 using 49 of 125 paired
residues within cutoff distance 2.0
1l33 title:
Contributions of left-handed helical residues to the structure and stability
of bacteriophage T4 lysozyme [more info...]
Chain information for 1l33 #284
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l33 chain A to query has RMSD 1.03 using 49 of 125 paired
residues within cutoff distance 2.0
1c64 title:
T4 lysozyme mutant C54T/C97A/L121A In the presence of 8 atm krypton [more
info...]
Chain information for 1c64 #285
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164
Non-standard residues in 1c64 #285
---
BME — β-mercaptoethanol
CL — chloride ion
KR — krypton
Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1c64 chain A to query has RMSD 1.03 using 50 of 126 paired
residues within cutoff distance 2.0
241l title:
The response of T4 lysozyme to large-to-small substitutions within the core
and its relation to the hydrophobic effect [more info...]
Chain information for 241l #286
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 241l #286
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 241l chain A to query has RMSD 0.932 using 46 of 125 paired
residues within cutoff distance 2.0
1t97 title:
Use of sequence duplication to engineer a ligand-triggered long-distance
molecular switch in T4 Lysozyme [more info...]
Chain information for 1t97 #287
---
Chain | Description | UniProt
A B | Lysozyme | LYS_BPT4 1-175
1t97 mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 60 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 1t97 chain A to query has RMSD 0.91 using 45 of 131 paired
residues within cutoff distance 2.0
1cv4 title:
T4 lysozyme mutant L118M [more info...]
Chain information for 1cv4 #288
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1cv4 #288
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1cv4 chain A to query has RMSD 1.02 using 48 of 125 paired
residues within cutoff distance 2.0
159l title:
Control of enzyme activity by an engineered disulfide bond [more info...]
Chain information for 159l #289
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 159l #289
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 159l chain A to query has RMSD 0.945 using 47 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 6m9t from http://files.rcsb.org/download/6m9t.cif
Fetching CCD J9P from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/J9P/J9P.cif
6m9t title:
Crystal structure of EP3 receptor bound to misoprostol-FA [more info...]
Chain information for 6m9t #290
---
Chain | Description | UniProt
A | Prostaglandin E2 receptor EP3 subtype, Endolysin chimera | PE2R3_HUMAN 2-259 273-353, ENLYS_BPT4 1002-1161
Non-standard residues in 6m9t #290
---
J9P —
(11alpha,12alpha,13E,16S)-11,16-dihydroxy-16-methyl-9-oxoprost-13-en-1-oic
acid
OLA — oleic acid
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
SO4 — sulfate ion
22 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
3416 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 87 C-terminal residues, 204 N-terminal residues, 13 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 6m9t chain A to query has RMSD 1.38 using 75 of 128 paired
residues within cutoff distance 2.0
4e97 title:
T4 Lysozyme L99A/M102H with 2-Mercaptoethanol Bound [more info...]
Chain information for 4e97 #291
---
Chain | Description | UniProt
A B | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 4e97 #291
---
ACT — acetate ion
BME — β-mercaptoethanol
HED — 2-hydroxyethyl disulfide
SO4 — sulfate ion
4e97 mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
305 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
2848 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 11 C-terminal residues, 3 N-terminal residues, 288
non-polymer residues more than 3.0 Angstroms away.
Alignment of 4e97 chain B to query has RMSD 1.14 using 45 of 139 paired
residues within cutoff distance 2.0
253l title:
Lysozyme [more info...]
Chain information for 253l #292
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 253l #292
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 11 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 253l chain A to query has RMSD 0.936 using 46 of 125 paired
residues within cutoff distance 2.0
234l title:
T4 lysozyme mutant M106L [more info...]
Chain information for 234l #293
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 234l #293
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 234l chain A to query has RMSD 1.01 using 49 of 125 paired
residues within cutoff distance 2.0
1qug title:
E108V mutant of T4 lysozyme [more info...]
Chain information for 1qug #294
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162
Non-standard residues in 1qug #294
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 43 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1qug chain A to query has RMSD 0.945 using 47 of 127 paired
residues within cutoff distance 2.0
1p64 title:
T4 lysozyme core repacking mutant L133F/Ta [more info...]
Chain information for 1p64 #295
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1p64 #295
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
K — potassium ion
13 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 84 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1p64 chain A to query has RMSD 1.02 using 48 of 125 paired
residues within cutoff distance 2.0
1l56 title:
Analysis of the interaction between charged side chains and the α-helix dipole
using designed thermostable mutants of phage T4 lysozyme [more info...]
Chain information for 1l56 #296
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l56 #296
---
BME — β-mercaptoethanol
Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l56 chain A to query has RMSD 0.937 using 45 of 127 paired
residues within cutoff distance 2.0
1g0q title:
Crystal structure of T4 lysozyme mutant V149I [more info...]
Chain information for 1g0q #297
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1g0q #297
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1g0q chain A to query has RMSD 1.02 using 49 of 127 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1dye from http://files.rcsb.org/download/1dye.cif
1dye title:
Determination of α-helix propensity within the context of A folded protein:
sites 44 and 131 In bacteriophage T4 lysozyme [more info...]
Chain information for 1dye #298
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1dye #298
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1dye chain A to query has RMSD 1.05 using 49 of 127 paired
residues within cutoff distance 2.0
156l title:
Control of enzyme activity by an engineered disulfide bond [more info...]
Chain information for 156l #299
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 156l #299
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 78 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 156l chain A to query has RMSD 0.973 using 47 of 125 paired
residues within cutoff distance 2.0
109l title:
Structural basis of α-helix propensity At two sites In T4 lysozyme [more
info...]
Chain information for 109l #300
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 109l #300
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 109l chain A to query has RMSD 0.986 using 44 of 122 paired
residues within cutoff distance 2.0
4i7j title:
T4 Lysozyme L99A/M102H with benzene bound [more info...]
Chain information for 4i7j #301
---
Chain | Description | UniProt
A B | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 4i7j #301
---
ACT — acetate ion
BME — β-mercaptoethanol
BNZ — benzene
HED — 2-hydroxyethyl disulfide
SO4 — sulfate ion
4i7j mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
104 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
2809 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 11 C-terminal residues, 13 N-terminal residues, 178
non-polymer residues more than 3.0 Angstroms away.
Alignment of 4i7j chain A to query has RMSD 1.2 using 47 of 126 paired
residues within cutoff distance 2.0
257l title:
AN adaptable metal-binding site engineered INTO T4 lysozyme [more info...]
Chain information for 257l #302
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 257l #302
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 257l chain A to query has RMSD 1.03 using 49 of 125 paired
residues within cutoff distance 2.0
248l title:
The response of T4 lysozyme to large-to-small substitutions within the core
and its relation to the hydrophobic effect [more info...]
Chain information for 248l #303
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 248l #303
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 248l chain A to query has RMSD 0.908 using 45 of 125 paired
residues within cutoff distance 2.0
246l title:
The response of T4 lysozyme to large-to-small substitutions within the core
and its relation to the hydrophobic effect [more info...]
Chain information for 246l #304
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 246l #304
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 246l chain A to query has RMSD 0.973 using 48 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1l0k from http://files.rcsb.org/download/1l0k.cif
1l0k title:
Methionine core mutant of T4 lysozyme [more info...]
Chain information for 1l0k #305
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-162
Non-standard residues in 1l0k #305
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 51 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l0k chain A to query has RMSD 0.938 using 41 of 122 paired
residues within cutoff distance 2.0
1d3f title:
N-terminal domain core methionine mutation [more info...]
Chain information for 1d3f #306
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1d3f #306
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 51 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1d3f chain A to query has RMSD 0.99 using 48 of 125 paired
residues within cutoff distance 2.0
1c60 title:
T4 lysozyme mutant C54T/C97A/F153A In the presence of 8 atm argon [more
info...]
Chain information for 1c60 #307
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164
Non-standard residues in 1c60 #307
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1c60 chain A to query has RMSD 1.02 using 49 of 125 paired
residues within cutoff distance 2.0
165l title:
Control of enzyme activity by an engineered disulfide bond [more info...]
Chain information for 165l #308
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 165l #308
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 165l chain A to query has RMSD 0.994 using 48 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 6d9m from http://files.rcsb.org/download/6d9m.cif
Fetching CCD GMP from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/GMP/GMP.cif
Fetching CCD GTP from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/GTP/GTP.cif
Fetching CCD POP from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/POP/POP.cif
6d9m title:
T4-Lysozyme fusion to Geobacter GGDEF [more info...]
Chain information for 6d9m #309
---
Chain | Description | UniProt
A | Fusion protein of Endolysin,Response receiver sensor diguanylate cyclase, GAF domain-containing | D9IEF7_BPT4 -162--2, Q39UD1_GEOMG 1-166
Non-standard residues in 6d9m #309
---
ACT — acetate ion
GMP — guanosine
GOL — glycerol (glycerin; propane-1,2,3-triol)
GTP — guanosine-5'-triphosphate
MG — magnesium ion
POP — pyrophosphate 2-
196 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
2577 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 173 C-terminal residues, 2 N-terminal residues, 301 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 6d9m chain A to query has RMSD 1.3 using 57 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 5v83 from http://files.rcsb.org/download/5v83.cif
Fetching CCD 8Z7 from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/7/8Z7/8Z7.cif
5v83 title:
Structure of DCN1 bound to NAcM-HIT [more info...]
Chain information for 5v83 #310
---
Chain | Description | UniProt
A | Lysozyme,DCN1-like protein 1 chimera | D9IEF7_BPT4 1-164, DCNL1_HUMAN 1062-1259
Non-standard residues in 5v83 #310
---
8Z7 — N-(1-benzylpiperidin-4-yl)-N'-[3-(trifluoromethyl)phenyl]urea
2925 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 199 C-terminal residues, 14 N-terminal residues, 198 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 5v83 chain A to query has RMSD 1.22 using 64 of 121 paired
residues within cutoff distance 2.0
5jww title:
T4 Lysozyme L99A/M102Q with 1-Hydro-2-ethyl-1,2-azaborine Bound [more info...]
Chain information for 5jww #311
---
Chain | Description | UniProt
A | Endolysin | ENLYS_BPT4 1-164
Non-standard residues in 5jww #311
---
6OQ — 2-ethyl-1,2-dihydro-1,2-azaborinine
CL — chloride ion
95 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 8 C-terminal residues, 2 N-terminal residues, 162 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 5jww chain A to query has RMSD 0.963 using 43 of 122 paired
residues within cutoff distance 2.0
1l25 title:
Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
protein stability [more info...]
Chain information for 1l25 #312
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 82 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l25 chain A to query has RMSD 1.08 using 49 of 125 paired
residues within cutoff distance 2.0
198l title:
Thermodynamic and structural compensation In "size-switch" core-repacking
variants of T4 lysozyme [more info...]
Chain information for 198l #313
---
Chain | Description | UniProt
A | LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 198l #313
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 81 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 198l chain A to query has RMSD 0.988 using 50 of 125 paired
residues within cutoff distance 2.0
149l title:
Conservation of solvent-binding sites In 10 crystal forms of T4 lysozyme [more
info...]
Chain information for 149l #314
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 15 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 149l chain A to query has RMSD 1.35 using 63 of 124 paired
residues within cutoff distance 2.0
5x33 title:
Leukotriene B4 receptor BLT1 in complex with BIIL260 [more info...]
Chain information for 5x33 #315
---
Chain | Description | UniProt
A | LTB4 receptor,Lysozyme,LTB4 receptor | Q9WTK1_CAVPO 15-213 214-348, A0A097J792_BPT4 1002-1161
Non-standard residues in 5x33 #315
---
7Y9 —
4-[[3-[[4-[2-(4-hydroxyphenyl)propan-2-yl]phenoxy]methyl]phenyl]methoxy]benzenecarboximidamide
3375 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 83 C-terminal residues, 186 N-terminal residues, 1 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 5x33 chain A to query has RMSD 1.08 using 53 of 141 paired
residues within cutoff distance 2.0
221l title:
The energetic cost and the structural consequences of burying A hydroxyl group
within the core of A protein determined from ala to ser and val to THR
substitutions In T4 lysozyme [more info...]
Chain information for 221l #316
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 221l #316
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 54 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 221l chain A to query has RMSD 1 using 49 of 125 paired residues
within cutoff distance 2.0
Fetching compressed mmCIF 1l68 from http://files.rcsb.org/download/1l68.cif
1l68 title:
Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A
polyalanine α-helix containing ten consecutive alanines [more info...]
Chain information for 1l68 #317
---
Chain | Description | UniProt
A | LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l68 #317
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l68 chain A to query has RMSD 0.936 using 47 of 125 paired
residues within cutoff distance 2.0
1l27 title:
Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
protein stability [more info...]
Chain information for 1l27 #318
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l27 chain A to query has RMSD 1 using 47 of 127 paired residues
within cutoff distance 2.0
1g1w title:
T4 lysozyme mutant C54T/C97A/Q105M [more info...]
Chain information for 1g1w #319
---
Chain | Description | UniProt
A | LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1g1w #319
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1g1w chain A to query has RMSD 1.03 using 49 of 127 paired
residues within cutoff distance 2.0
1cup title:
Methionine core mutant of T4 lysozyme [more info...]
Chain information for 1cup #320
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1cup #320
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1cup chain A to query has RMSD 1.03 using 49 of 125 paired
residues within cutoff distance 2.0
6iih title:
crystal structure of mitochondrial calcium uptake 2(MICU2) [more info...]
Chain information for 6iih #321
---
Chain | Description | UniProt
A B | Endolysin,Calcium uptake protein 2, mitochondrial | ENLYS_BPT4 1-161, MICU2_HUMAN 164-485
Non-standard residues in 6iih #321
---
CA — calcium ion
Deleted 1 extra chains, 293 C-terminal residues, 2 N-terminal residues, 675
non-polymer residues more than 3.0 Angstroms away.
Alignment of 6iih chain A to query has RMSD 0.865 using 44 of 124 paired
residues within cutoff distance 2.0
210l title:
Protein structure plasticity exemplified by insertion and deletion mutants In
T4 lysozyme [more info...]
Chain information for 210l #322
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 210l #322
---
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 210l chain A to query has RMSD 0.947 using 45 of 127 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1l71 from http://files.rcsb.org/download/1l71.cif
1l71 title:
Multiple stabilizing alanine replacements within α-helix 126-134 of T4
lysozyme have independent, additive effects on both structure and stability
[more info...]
Chain information for 1l71 #323
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l71 #323
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 7 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l71 chain A to query has RMSD 1.03 using 48 of 127 paired
residues within cutoff distance 2.0
1cv0 title:
T4 lysozyme mutant F104M [more info...]
Chain information for 1cv0 #324
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1cv0 #324
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1cv0 chain A to query has RMSD 1.02 using 49 of 125 paired
residues within cutoff distance 2.0
1c67 title:
T4 lysozyme mutant C54T/C97A/L121A/L133A In the presence of 8 atm krypton
[more info...]
Chain information for 1c67 #325
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164
Non-standard residues in 1c67 #325
---
BME — β-mercaptoethanol
CL — chloride ion
KR — krypton
Deleted 9 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1c67 chain A to query has RMSD 1.09 using 50 of 125 paired
residues within cutoff distance 2.0
175l title:
Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
[more info...]
Chain information for 175l #326
---
Chain | Description | UniProt
A B | T4 LYSOZYME | LYS_BPT4 1-164
175l mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 65 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 175l chain A to query has RMSD 0.951 using 47 of 128 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 170l from http://files.rcsb.org/download/170l.cif
170l title:
Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
[more info...]
Chain information for 170l #327
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 170l #327
---
BME — β-mercaptoethanol
Deleted 11 C-terminal residues, 2 N-terminal residues, 6 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 170l chain A to query has RMSD 0.917 using 45 of 125 paired
residues within cutoff distance 2.0
142l title:
Role of backbone flexibility In the accommodation of variants that repack the
core of T4 lysozyme [more info...]
Chain information for 142l #328
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 142l #328
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 48 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 142l chain A to query has RMSD 1.07 using 49 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 3vw7 from http://files.rcsb.org/download/3vw7.cif
Fetching CCD VPX from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/X/VPX/VPX.cif
3vw7 title:
Crystal structure of human protease-activated receptor 1 (PAR1) bound with
antagonist vorapaxar at 2.2 angstrom [more info...]
Chain information for 3vw7 #329
---
Chain | Description | UniProt
A | Proteinase-activated receptor 1, Lysozyme | PAR1_HUMAN 86-301 303-395, LYS_BPT4 1002-1161
Non-standard residues in 3vw7 #329
---
CL — chloride ion
NA — sodium ion
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
VPX — ethyl
[(1R,3aR,4aR,6R,8aR,9S,9aS)-9-{(E)-2-[5-(3-fluorophenyl)pyridin-2-yl]ethenyl}-1-methyl-3-oxododecahydronaphtho[2,3-c]fur
an-6-yl]carbamate (vorapaxar)
3 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
3817 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 84 C-terminal residues, 207 N-terminal residues, 80 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 3vw7 chain A to query has RMSD 1.34 using 58 of 125 paired
residues within cutoff distance 2.0
3c83 title:
Bacteriophage T4 lysozyme mutant D89A in wildtype background at room
temperature [more info...]
Chain information for 3c83 #330
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 3c83 #330
---
BME — β-mercaptoethanol
CL — chloride ion
18 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3c83 chain A to query has RMSD 0.962 using 47 of 125 paired
residues within cutoff distance 2.0
2ou8 title:
Structure of Spin-labeled T4 Lysozyme Mutant T115R1 at Room Temperature [more
info...]
Chain information for 2ou8 #331
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 2ou8 #331
---
BME — β-mercaptoethanol
MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
methanesulfonothioate (MTSL)
13 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 46 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 2ou8 chain A to query has RMSD 1.01 using 48 of 125 paired
residues within cutoff distance 2.0
1l91 title:
Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
lysozyme have different structural and thermodynamic consequences [more
info...]
Chain information for 1l91 #332
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l91 #332
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l91 chain A to query has RMSD 1 using 48 of 125 paired residues
within cutoff distance 2.0
1l76 title:
Tolerance of T4 lysozyme to proline substitutions within the long interdomain
α-helix illustrates the adaptability of proteins to potentially destabilizing
lesions [more info...]
Chain information for 1l76 #333
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l76 #333
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l76 chain A to query has RMSD 0.95 using 44 of 124 paired
residues within cutoff distance 2.0
1l24 title:
Enhanced protein thermostability from site-directed mutations that decrease
the entropy of unfolding [more info...]
Chain information for 1l24 #334
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l24 chain A to query has RMSD 1.05 using 50 of 125 paired
residues within cutoff distance 2.0
228l title:
Generating ligand binding sites In T4 lysozyme using deficiency-creating
substitutions [more info...]
Chain information for 228l #335
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 228l #335
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 228l chain A to query has RMSD 0.952 using 47 of 125 paired
residues within cutoff distance 2.0
1xep title:
Catechol in complex with T4 lysozyme L99A/M102Q [more info...]
Chain information for 1xep #336
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 1xep #336
---
BME — β-mercaptoethanol
CAQ — catechol (1,2-dihydroxybenzene)
PO4 — phosphate ion
80 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 9 C-terminal residues, 2 N-terminal residues, 140 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1xep chain A to query has RMSD 0.943 using 45 of 125 paired
residues within cutoff distance 2.0
1l46 title:
Cumulative site-directed charge-change replacements In bacteriophage T4
lysozyme suggest that long-range electrostatic interactions contribute little
to protein stability [more info...]
Chain information for 1l46 #337
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 79 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l46 chain A to query has RMSD 0.981 using 47 of 127 paired
residues within cutoff distance 2.0
1l20 title:
Enhanced protein thermostability from designed mutations that interact with
α-helix dipoles [more info...]
Chain information for 1l20 #338
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l20 chain A to query has RMSD 0.993 using 47 of 124 paired
residues within cutoff distance 2.0
1l03 title:
Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
phage T4 lysozyme [more info...]
Chain information for 1l03 #339
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l03 #339
---
BME — β-mercaptoethanol
Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l03 chain A to query has RMSD 1.03 using 49 of 125 paired
residues within cutoff distance 2.0
1dyg title:
Determination of α-helix propensity within the context of A folded protein:
sites 44 and 131 In bacteriophage T4 lysozyme [more info...]
Chain information for 1dyg #340
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1dyg #340
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1dyg chain A to query has RMSD 0.938 using 45 of 127 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 157l from http://files.rcsb.org/download/157l.cif
157l title:
Control of enzyme activity by an engineered disulfide bond [more info...]
Chain information for 157l #341
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 157l #341
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 157l chain A to query has RMSD 0.978 using 47 of 127 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 6xyr from http://files.rcsb.org/download/6xyr.cif
6xyr title:
Structure of the T4Lnano fusion protein [more info...]
Chain information for 6xyr #342
---
Chain | Description | UniProt
A | T4Lnano,Endolysin,Calmodulin,Endolysin,Calmodulin-1 | ENLYS_BPT4 37-199, CALM1_HUMAN 214-361
Non-standard residues in 6xyr #342
---
CA — calcium ion
CL — chloride ion
GOL — glycerol (glycerin; propane-1,2,3-triol)
Deleted 163 C-terminal residues, 34 N-terminal residues, 75 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 6xyr chain A to query has RMSD 1.1 using 52 of 124 paired
residues within cutoff distance 2.0
222l title:
Generating ligand binding sites In T4 lysozyme using deficiency-creating
substitutions [more info...]
Chain information for 222l #343
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 222l #343
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 222l chain A to query has RMSD 1.02 using 49 of 125 paired
residues within cutoff distance 2.0
174l title:
Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
[more info...]
Chain information for 174l #344
---
Chain | Description | UniProt
A B | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 174l #344
---
SO4 — sulfate ion
174l mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
5 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 32 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 174l chain B to query has RMSD 1.31 using 77 of 128 paired
residues within cutoff distance 2.0
6p5w title:
Structure of DCN1 bound to
3-methyl-N-((4S,5S)-3-methyl-6-oxo-1-phenyl-4-(p-tolyl)-4,5,6,7-tetrahydro-1H-pyrazolo[3,4-b]pyridin-5-yl)benzamide
[more info...]
Chain information for 6p5w #345
---
Chain | Description | UniProt
A | Lysozyme,DCN1-like protein 1 chimera | D9IEF7_BPT4 1-164, DCNL1_HUMAN 1062-1259
Non-standard residues in 6p5w #345
---
O0A —
3-methyl-N-[(4S,5S)-3-methyl-4-(4-methylphenyl)-6-oxo-1-phenyl-4,5,6,7-tetrahydro-1H-pyrazolo[3,4-b]pyridin-5-yl]benzamide
2996 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 204 C-terminal residues, 15 N-terminal residues, 200 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 6p5w chain A to query has RMSD 1.11 using 55 of 121 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 6fw2 from http://files.rcsb.org/download/6fw2.cif
Fetching CCD MOO from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/O/MOO/MOO.cif
6fw2 title:
Crystal Structure of human mARC1 [more info...]
Chain information for 6fw2 #346
---
Chain | Description | UniProt
A | Mitochondrial amidoxime-reducing component 1,Endolysin,Mitochondrial amidoxime-reducing component 1 | MARC1_HUMAN 53-128 131-336, D9IEF7_BPT4 1001-1161
Non-standard residues in 6fw2 #346
---
B3P — 2-[3-(2-hydroxy-1,1-dihydroxymethyl-
ethylamino)-propylamino]-2-hydroxymethyl-propane-1,3-diol
EFK — oxidanyl(oxidanylidene)molybdenum
MOO — molybdate ion (molybdate)
MTE — phosphonic
acidmono-(2-amino-5,6-dimercapto-4-oxo-3,7,8A,9,10,10A-hexahydro-4H-8-oxa-1,3,9,10-tetraaza-
anthracen-7-ylmethyl)ester
PO4 — phosphate ion
53 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 214 C-terminal residues, 79 N-terminal residues, 340 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 6fw2 chain A to query has RMSD 0.933 using 47 of 127 paired
residues within cutoff distance 2.0
256l title:
Bacteriophage T4 lysozyme [more info...]
Chain information for 256l #347
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 256l chain A to query has RMSD 1.02 using 48 of 125 paired
residues within cutoff distance 2.0
247l title:
The response of T4 lysozyme to large-to-small substitutions within the core
and its relation to the hydrophobic effect [more info...]
Chain information for 247l #348
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 247l #348
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
1 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 247l chain A to query has RMSD 0.961 using 46 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 242l from http://files.rcsb.org/download/242l.cif
242l title:
The response of T4 lysozyme to large-to-small substitutions within the core
and its relation to the hydrophobic effect [more info...]
Chain information for 242l #349
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 242l #349
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 11 C-terminal residues, 2 N-terminal residues, 87 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 242l chain A to query has RMSD 0.994 using 48 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1l94 from http://files.rcsb.org/download/1l94.cif
1l94 title:
Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
lysozyme have different structural and thermodynamic consequences [more
info...]
Chain information for 1l94 #350
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1l94 #350
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l94 chain A to query has RMSD 1.04 using 49 of 125 paired
residues within cutoff distance 2.0
1cu0 title:
T4 lysozyme mutant I78M [more info...]
Chain information for 1cu0 #351
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1cu0 #351
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1cu0 chain A to query has RMSD 1.02 using 47 of 123 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 150l from http://files.rcsb.org/download/150l.cif
150l title:
Conservation of solvent-binding sites In 10 crystal forms of T4 lysozyme [more
info...]
Chain information for 150l #352
---
Chain | Description | UniProt
A B C D | T4 LYSOZYME | LYS_BPT4 1-164
150l mmCIF Assemblies
---
1| author_defined_assembly
2| author_and_software_defined_assembly
3| author_defined_assembly
4| author_and_software_defined_assembly
Deleted 3 extra chains, 9 C-terminal residues, 3 N-terminal residues, 155 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 150l chain B to query has RMSD 1.4 using 59 of 124 paired
residues within cutoff distance 2.0
5wf5 title:
Agonist bound human A2a adenosine receptor with D52N mutation at 2.60 A
resolution [more info...]
Chain information for 5wf5 #353
---
Chain | Description | UniProt
A | Human A2a adenosine receptor T4L chimera | AA2AR_HUMAN 2-208 222-316, ENLYS_BPT4 1002-1161
Non-standard residues in 5wf5 #353
---
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
UKA —
6-(2,2-diphenylethylamino)-9-[(2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxy-
oxolan-2-yl]-N-[2-[(1-pyridin-2-ylpiperidin-4-yl)carbamoylamino]ethyl]purine-2-carboxamide
17 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 94 C-terminal residues, 199 N-terminal residues, 4 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 5wf5 chain A to query has RMSD 1.18 using 60 of 121 paired
residues within cutoff distance 2.0
1lyh title:
Dissection of helix capping In T4 lysozyme by structural and thermodynamic
analysis of six amino acid substitutions At THR 59 [more info...]
Chain information for 1lyh #354
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 1lyh #354
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1lyh chain A to query has RMSD 0.99 using 48 of 125 paired
residues within cutoff distance 2.0
1l69 title:
Multiple stabilizing alanine replacements within α-helix 126-134 of T4
lysozyme have independent, additive effects on both structure and stability
[more info...]
Chain information for 1l69 #355
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1l69 #355
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l69 chain A to query has RMSD 1.07 using 48 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 173l from http://files.rcsb.org/download/173l.cif
173l title:
Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
[more info...]
Chain information for 173l #356
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 173l #356
---
BME — β-mercaptoethanol
Deleted 9 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 173l chain A to query has RMSD 1.35 using 68 of 124 paired
residues within cutoff distance 2.0
141l title:
Role of backbone flexibility In the accommodation of variants that repack the
core of T4 lysozyme [more info...]
Chain information for 141l #357
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 141l #357
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 54 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 141l chain A to query has RMSD 1.08 using 48 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 7mwz from http://files.rcsb.org/download/7mwz.cif
Fetching CCD 4UR from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/R/4UR/4UR.cif
7mwz title:
Structure of drosophila STING in complex with 3'2'-cGAMP [more info...]
Chain information for 7mwz #358
---
Chain | Description
A B C D | STING
Non-standard residues in 7mwz #358
---
4UR — 3'2'-cGAMP
(2-amino-9-[(2S,5R,7R,8R,10R,12aR,14R,15R,15aS,16R)-7-(6-amino-9H-purin-9-yl)-2,10,15,16-tetrahydroxy-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2-l][1,3,6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl]-1,9-dihydro-6H-purin-6-one)
7mwz mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
10943 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 3 extra chains, 197 C-terminal residues, 3 N-terminal residues, 473
non-polymer residues more than 3.0 Angstroms away.
Alignment of 7mwz chain A to query has RMSD 1.11 using 58 of 124 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 6ffh from http://files.rcsb.org/download/6ffh.cif
Fetching CCD D7W from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/W/D7W/D7W.cif
Fetching CCD YCM from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/M/YCM/YCM.cif
6ffh title:
Crystal Structure of mGluR5 in complex with Fenobam at 2.65 A [more info...]
Chain information for 6ffh #359
---
Chain | Description | UniProt
A | Metabotropic glutamate receptor 5,Endolysin | GRM5_HUMAN 569-678 1679-1836, ENLYS_BPT4 1002-1161
Non-standard residues in 6ffh #359
---
D7W — 1-(3-chlorophenyl)-3-(3-methyl-5-oxidanylidene-4~{H}-imidazol-2-yl)urea
MES — 2-(N-morpholino)-ethanesulfonic acid
OLA — oleic acid
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
3307 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 151 C-terminal residues, 112 N-terminal residues, 16 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 6ffh chain A to query has RMSD 1.18 using 65 of 126 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 3sb7 from http://files.rcsb.org/download/3sb7.cif
3sb7 title:
Cu-mediated Trimer of T4 Lysozyme D61H/K65H/R76H/R80H by Synthetic
Symmetrization [more info...]
Chain information for 3sb7 #360
---
Chain | Description | UniProt
A B | Lysozyme | LYS_BPT4 1-162
Non-standard residues in 3sb7 #360
---
CU — copper (II) ion
GOL — glycerol (glycerin; propane-1,2,3-triol)
3sb7 mmCIF Assemblies
---
1| author_defined_assembly
2| author_and_software_defined_assembly
2579 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 9 C-terminal residues, 3 N-terminal residues, 24 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 3sb7 chain A to query has RMSD 0.967 using 44 of 124 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1cu3 from http://files.rcsb.org/download/1cu3.cif
1cu3 title:
T4 lysozyme mutant V87M [more info...]
Chain information for 1cu3 #361
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1cu3 #361
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1cu3 chain A to query has RMSD 1.01 using 47 of 125 paired
residues within cutoff distance 2.0
3oe0 title:
Crystal structure of the CXCR4 chemokine receptor in complex with a cyclic
peptide antagonist CVX15 [more info...]
Chain information for 3oe0 #362
---
Chain | Description | UniProt
A | C-X-C chemokine receptor type 4, Lysozyme Chimera | CXCR4_HUMAN 2-228 231-319, LYS_BPT4 1002-1161
I | Polyphemusin analog, CXC chemokine receptor antagonist |
3oe0 mmCIF Assemblies
---
1| author_defined_assembly
3484 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 81 C-terminal residues, 197 N-terminal residues, 5
non-polymer residues more than 3.0 Angstroms away.
Alignment of 3oe0 chain A to query has RMSD 1.02 using 55 of 131 paired
residues within cutoff distance 2.0
250l title:
The response of T4 lysozyme to large-to-small substitutions within the core
and its relation to the hydrophobic effect [more info...]
Chain information for 250l #363
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 250l #363
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 250l chain A to query has RMSD 0.938 using 46 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 209l from http://files.rcsb.org/download/209l.cif
209l title:
Protein structure plasticity exemplified by insertion and deletion mutants In
T4 lysozyme [more info...]
Chain information for 209l #364
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 8 C-terminal residues, 2 N-terminal residues, 11 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 209l chain A to query has RMSD 1.01 using 48 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1p37 from http://files.rcsb.org/download/1p37.cif
1p37 title:
T4 lysozyme core repacking back-revertant L102M/CORE10 [more info...]
Chain information for 1p37 #365
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1p37 #365
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
K — potassium ion
14 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 11 C-terminal residues, 2 N-terminal residues, 118 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 1p37 chain A to query has RMSD 0.93 using 45 of 127 paired
residues within cutoff distance 2.0
1l45 title:
Cumulative site-directed charge-change replacements In bacteriophage T4
lysozyme suggest that long-range electrostatic interactions contribute little
to protein stability [more info...]
Chain information for 1l45 #366
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l45 chain A to query has RMSD 1.01 using 48 of 125 paired
residues within cutoff distance 2.0
1c6b title:
T4 lysozyme mutant C54T/C97A/L133A In the presence of 8 atm xenon [more
info...]
Chain information for 1c6b #367
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164
Non-standard residues in 1c6b #367
---
BME — β-mercaptoethanol
CL — chloride ion
XE — XENON
Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1c6b chain A to query has RMSD 1.03 using 48 of 125 paired
residues within cutoff distance 2.0
4rws title:
Crystal structure of CXCR4 and viral chemokine antagonist vMIP-II complex (PSI
Community Target) [more info...]
Chain information for 4rws #368
---
Chain | Description | UniProt
A | C-X-C chemokine receptor type 4/Endolysin chimeric protein | CXCR4_HUMAN 2-228 231-319, LYS_BPT4 1002-1161
C | Viral macrophage inflammatory protein 2 | VMI2_HHV8P 1-71
3953 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 84 C-terminal residues, 200 N-terminal residues.
Alignment of 4rws chain A to query has RMSD 1.05 using 54 of 126 paired
residues within cutoff distance 2.0
244l title:
The response of T4 lysozyme to large-to-small substitutions within the core
and its relation to the hydrophobic effect [more info...]
Chain information for 244l #369
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 244l #369
---
BME — β-mercaptoethanol
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 244l chain A to query has RMSD 0.971 using 48 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 6kk7 from http://files.rcsb.org/download/6kk7.cif
Fetching CCD 97Y from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/Y/97Y/97Y.cif
6kk7 title:
Structure of thermal-stabilised(M6) human GLP-1 receptor transmembrane domain
[more info...]
Chain information for 6kk7 #370
---
Chain | Description | UniProt
A B | Glucagon-like peptide 1 receptor,Endolysin,Glucagon-like peptide 1 receptor | GLP1R_HUMAN 128-257 261-431, ENLYS_BPT4 1001-1160
Non-standard residues in 6kk7 #370
---
97Y —
N-{4-[(R)-(3,3-dimethylcyclobutyl)({6-[4-(trifluoromethyl)-1H-imidazol-1-yl]pyridin-3-yl}amino)methyl]benzene-1-carbonyl}-beta-
alanine
6kk7 mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
6590 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 162 C-terminal residues, 95 N-terminal residues, 2
non-polymer residues more than 3.0 Angstroms away.
Alignment of 6kk7 chain B to query has RMSD 0.929 using 46 of 142 paired
residues within cutoff distance 2.0
1l37 title:
Contributions of engineered surface salt bridges to the stability of T4
lysozyme determined by directed mutagenesis [more info...]
Chain information for 1l37 #371
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l37 chain A to query has RMSD 0.955 using 46 of 125 paired
residues within cutoff distance 2.0
1d2w title:
N-terminal domain core methionine mutation [more info...]
Chain information for 1d2w #372
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1d2w #372
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1d2w chain A to query has RMSD 0.959 using 47 of 127 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1quo from http://files.rcsb.org/download/1quo.cif
1quo title:
L99A/E108V mutant of T4 lysozyme [more info...]
Chain information for 1quo #373
---
Chain | Description | UniProt
A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162
Non-standard residues in 1quo #373
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 50 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1quo chain A to query has RMSD 1.02 using 49 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 6xc1 from http://files.rcsb.org/download/6xc1.cif
6xc1 title:
Crystal structure of bacteriophage T4 spackle and lysozyme in orthorhombic
form [more info...]
Chain information for 6xc1 #374
---
Chain | Description | UniProt
A | Lysozyme | BP5_BPT4 174-342
C | Protein spackle | SPAC_BPT4 1-97
Non-standard residues in 6xc1 #374
---
EDO — 1,2-ethanediol (ethylene glycol)
IPA — isopropyl alcohol (2-propanol)
36 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
1923 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 10 C-terminal residues, 1 N-terminal residues, 74 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 6xc1 chain A to query has RMSD 1.36 using 51 of 127 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 5zty from http://files.rcsb.org/download/5zty.cif
Fetching CCD 9JU from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/U/9JU/9JU.cif
Fetching CCD PG4 from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/4/PG4/PG4.cif
5zty title:
Crystal structure of human G protein coupled receptor [more info...]
Chain information for 5zty #375
---
Chain | Description | UniProt
A | G protein coupled receptor,T4 lysozyme,G protein coupled receptor | CNR2_HUMAN 21-222 235-325, D9IEF7_BPT4 1001-1160
Non-standard residues in 5zty #375
---
9JU —
N-(adamantan-1-yl)-1-(5-hydroxypentyl)-4-methyl-5-phenyl-1H-pyrazole-3-carboxamide
EPE — 4-(2-hydroxyethyl)-1-piperazine ethanesulfonic acid (HEPES)
OLA — oleic acid
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
PEG — di(hydroxyethyl)ether
PG4 — tetraethylene glycol
SO4 — sulfate ion
15 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
3508 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 93 C-terminal residues, 200 N-terminal residues, 48 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 5zty chain A to query has RMSD 1.11 using 44 of 127 paired
residues within cutoff distance 2.0
1xju title:
Crystal structure of secreted inactive form of P1 phage endolysin Lyz [more
info...]
Chain information for 1xju #376
---
Chain | Description | UniProt
A B | Lysozyme | LYS_BPP1 29-185
Non-standard residues in 1xju #376
---
SO4 — sulfate ion
1xju mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
3| software_defined_assembly
Deleted 1 extra chains, 8 C-terminal residues, 35 N-terminal residues, 469
non-polymer residues more than 3.0 Angstroms away.
Alignment of 1xju chain A to query has RMSD 0.97 using 63 of 101 paired
residues within cutoff distance 2.0
1owz title:
T4 Lysozyme Cavity Mutant L99A/M102Q Bound With 4-FluoroPhenEthyl Alcohol
[more info...]
Chain information for 1owz #377
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 1owz #377
---
4FA — 4-fluorophenethyl alcohol
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 19 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1owz chain A to query has RMSD 0.974 using 44 of 122 paired
residues within cutoff distance 2.0
7e40 title:
Mechanism of Phosphate Sensing and Signaling Revealed by Rice SPX1-PHR2
Complex Structure [more info...]
Chain information for 7e40 #378
---
Chain | Description | UniProt
A C | Protein PHOSPHATE STARVATION RESPONSE 2 | PHR2_ORYSJ 248-380
B D | SPX domain-containing protein 1,Endolysin | SPX1_ORYSJ 1-198, D9IEF7_BPT4 199-357
Non-standard residues in 7e40 #378
---
IHP — inositol hexakisphosphate (myo-inositol hexakisphosphate; inositol
1,2,3,4,5,6-hexakisphosphate)
7e40 mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
7193 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 3 extra chains, 8 C-terminal residues, 137 N-terminal residues, 14
non-polymer residues more than 3.0 Angstroms away.
Alignment of 7e40 chain B to query has RMSD 1.27 using 61 of 158 paired
residues within cutoff distance 2.0
4n9n title:
Crystal Structure of Saccharomyces cerevisiae Upc2 Transcription Factor fused
with T4 Lysozyme [more info...]
Chain information for 4n9n #379
---
Chain | Description | UniProt
A B | Sterol uptake control protein 2, Lysozyme | UPC2_YEAST 598-714 726-878, LYS_BPT4 1002-1161
Deleted 1 extra chains, 163 C-terminal residues, 112 N-terminal residues, 24
non-polymer residues more than 3.0 Angstroms away.
Alignment of 4n9n chain A to query has RMSD 1.24 using 69 of 122 paired
residues within cutoff distance 2.0
4evx title:
Crystal structure of putative phage endolysin from S. enterica [more info...]
Chain information for 4evx #380
---
Chain | Description | UniProt
A B | Putative phage endolysin | Q8ZLC6_SALTY 5-107
4evx mmCIF Assemblies
---
1| software_defined_assembly
2| software_defined_assembly
3| software_defined_assembly
4| software_defined_assembly
37 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
1570 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 63 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 4evx chain A to query has RMSD 0.878 using 43 of 85 paired
residues within cutoff distance 2.0
3oe8 title:
Crystal structure of the CXCR4 chemokine receptor in complex with a small
molecule antagonist IT1t in P1 spacegroup [more info...]
Chain information for 3oe8 #381
---
Chain | Description | UniProt
A B C | C-X-C chemokine receptor type 4, Lysozyme Chimera | CXCR4_HUMAN 2-229 230-319, LYS_BPT4 1002-1161
Non-standard residues in 3oe8 #381
---
ITD — (6,6-dimethyl-5,6-dihydroimidazo[2,1-b][1,3]thiazol-3-yl)methyl
N,N'-dicyclohexylimidothiocarbamate
3oe8 mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| software_defined_assembly
3| software_defined_assembly
10292 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 2 extra chains, 82 C-terminal residues, 198 N-terminal residues, 3
non-polymer residues more than 3.0 Angstroms away.
Alignment of 3oe8 chain A to query has RMSD 1.02 using 48 of 124 paired
residues within cutoff distance 2.0
1xju title:
Crystal structure of secreted inactive form of P1 phage endolysin Lyz [more
info...]
Chain information for 1xju #382
---
Chain | Description | UniProt
A B | Lysozyme | LYS_BPP1 29-185
Non-standard residues in 1xju #382
---
SO4 — sulfate ion
1xju mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
3| software_defined_assembly
Deleted 1 extra chains, 8 C-terminal residues, 429 non-polymer residues more
than 3.0 Angstroms away.
Alignment of 1xju chain B to query has RMSD 0.983 using 72 of 125 paired
residues within cutoff distance 2.0
1cvk title:
T4 lysozyme mutant L118A [more info...]
Chain information for 1cvk #383
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-164
Non-standard residues in 1cvk #383
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1cvk chain A to query has RMSD 0.993 using 48 of 125 paired
residues within cutoff distance 2.0
143l title:
Role of backbone flexibility In the accommodation of variants that repack the
core of T4 lysozyme [more info...]
Chain information for 143l #384
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 143l #384
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 49 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 143l chain A to query has RMSD 1.05 using 50 of 125 paired
residues within cutoff distance 2.0
1l51 title:
Structural and thermodynamic analysis of the packing of two α-helices In
bacteriophage T4 lysozyme [more info...]
Chain information for 1l51 #385
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 11 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1l51 chain A to query has RMSD 1.03 using 46 of 127 paired
residues within cutoff distance 2.0
2nth title:
Structure of Spin-labeled T4 Lysozyme Mutant L118R1 [more info...]
Chain information for 2nth #386
---
Chain | Description | UniProt
A | Lysozyme | LYS_BPT4 1-164
Non-standard residues in 2nth #386
---
MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
methanesulfonothioate (MTSL)
Deleted 11 C-terminal residues, 2 N-terminal residues, 82 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 2nth chain A to query has RMSD 0.939 using 45 of 123 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1ky1 from http://files.rcsb.org/download/1ky1.cif
1ky1 title:
Methionine core mutant of T4 lysozyme [more info...]
Chain information for 1ky1 #387
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-162
Non-standard residues in 1ky1 #387
---
CL — chloride ion
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 53 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1ky1 chain A to query has RMSD 0.893 using 42 of 121 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 4k5y from http://files.rcsb.org/download/4k5y.cif
Fetching CCD PGW from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/W/PGW/PGW.cif
4k5y title:
Crystal structure of human corticotropin-releasing factor receptor 1 (CRF1R)
in complex with the antagonist CP-376395 [more info...]
Chain information for 4k5y #388
---
Chain | Description | UniProt
A B C | Corticotropin-releasing factor receptor 1, T4-Lysozyme chimeric construct | CRFR1_HUMAN 104-220 224-373, LYS_BPT4 1002-1161
Non-standard residues in 4k5y #388
---
1PE — pentaethylene glycol (PEG400)
1Q5 — 3,6-dimethyl-N-(pentan-3-yl)-2-(2,4,6-trimethylphenoxy)pyridin-4-amine
OLA — oleic acid
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
PGW —
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl
(9Z)-octadec-9-enoate (1-Palmitoyl-2-Oleoyl-sn-
Glycero-3-[Phospho-(1-glycerol)]; PHOSPHATIDYLGLYCEROL)
SO4 — sulfate ion
4k5y mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
Deleted 2 extra chains, 149 C-terminal residues, 107 N-terminal residues, 20
non-polymer residues more than 3.0 Angstroms away.
Alignment of 4k5y chain A to query has RMSD 1.35 using 73 of 124 paired
residues within cutoff distance 2.0
4k5y title:
Crystal structure of human corticotropin-releasing factor receptor 1 (CRF1R)
in complex with the antagonist CP-376395 [more info...]
Chain information for 4k5y #389
---
Chain | Description | UniProt
A B C | Corticotropin-releasing factor receptor 1, T4-Lysozyme chimeric construct | CRFR1_HUMAN 104-220 224-373, LYS_BPT4 1002-1161
Non-standard residues in 4k5y #389
---
1PE — pentaethylene glycol (PEG400)
1Q5 — 3,6-dimethyl-N-(pentan-3-yl)-2-(2,4,6-trimethylphenoxy)pyridin-4-amine
OLA — oleic acid
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
PGW —
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl
(9Z)-octadec-9-enoate (1-Palmitoyl-2-Oleoyl-sn-
Glycero-3-[Phospho-(1-glycerol)]; PHOSPHATIDYLGLYCEROL)
SO4 — sulfate ion
4k5y mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
Deleted 2 extra chains, 138 C-terminal residues, 107 N-terminal residues, 18
non-polymer residues more than 3.0 Angstroms away.
Alignment of 4k5y chain B to query has RMSD 1.3 using 73 of 126 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 140l from http://files.rcsb.org/download/140l.cif
140l title:
Role of backbone flexibility In the accommodation of variants that repack the
core of T4 lysozyme [more info...]
Chain information for 140l #390
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYCV_BPT4 1-164
Non-standard residues in 140l #390
---
BME — β-mercaptoethanol
CL — chloride ion
Deleted 9 C-terminal residues, 2 N-terminal residues, 50 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 140l chain A to query has RMSD 1.02 using 48 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 4ej4 from http://files.rcsb.org/download/4ej4.cif
Fetching CCD EJ4 from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/4/EJ4/EJ4.cif
4ej4 title:
Structure of the δ opioid receptor bound to naltrindole [more info...]
Chain information for 4ej4 #391
---
Chain | Description | UniProt
A | Delta-type opioid receptor, Lysozyme chimera | OPRD_MOUSE 36-244 251-342, LYS_BPT4 1002-1161
Non-standard residues in 4ej4 #391
---
EJ4 —
(4bS,8R,8aS,14bR)-7-(cyclopropylmethyl)-5,6,7,8,14,14b-hexahydro-4,8-methano[1]benzofuro[2,3-a]pyrido[4,3-b]carbazole-1,8a(9H)-diol
(Naltrindole)
Deleted 86 C-terminal residues, 205 N-terminal residues, 1 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 4ej4 chain A to query has RMSD 1.06 using 51 of 125 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 1qtd from http://files.rcsb.org/download/1qtd.cif
1qtd title:
The introduction of strain and its effects on the structure and stability of
T4 lysozyme [more info...]
Chain information for 1qtd #392
---
Chain | Description | UniProt
A | LYSOZYME | LYS_BPT4 1-162
Non-standard residues in 1qtd #392
---
HED — 2-hydroxyethyl disulfide
Deleted 9 C-terminal residues, 2 N-terminal residues, 26 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 1qtd chain A to query has RMSD 1.13 using 54 of 126 paired
residues within cutoff distance 2.0
4evx title:
Crystal structure of putative phage endolysin from S. enterica [more info...]
Chain information for 4evx #393
---
Chain | Description | UniProt
A B | Putative phage endolysin | Q8ZLC6_SALTY 5-107
4evx mmCIF Assemblies
---
1| software_defined_assembly
2| software_defined_assembly
3| software_defined_assembly
4| software_defined_assembly
37 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
1570 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 5 C-terminal residues, 64 non-polymer residues more
than 3.0 Angstroms away.
Alignment of 4evx chain B to query has RMSD 0.853 using 41 of 89 paired
residues within cutoff distance 2.0
218l title:
Protein structure plasticity exemplified by insertion and deletion mutants In
T4 lysozyme [more info...]
Chain information for 218l #394
---
Chain | Description | UniProt
A | T4 LYSOZYME | LYS_BPT4 1-164
Deleted 9 C-terminal residues, 2 N-terminal residues, 39 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 218l chain A to query has RMSD 1.2 using 53 of 122 paired
residues within cutoff distance 2.0
5zkq title:
Crystal structure of the human platelet-activating factor receptor in complex
with ABT-491 [more info...]
Chain information for 5zkq #395
---
Chain | Description | UniProt
A B | Platelet-activating factor receptor,Endolysin,Endolysin,Platelet-activating factor receptor | PTAFR_HUMAN 2-218 224-316, ENLYS_BPT4 1001-1010 1017-1117
Non-standard residues in 5zkq #395
---
9EU —
4-ethynyl-3-{3-fluoro-4-[(2-methyl-1H-imidazo[4,5-c]pyridin-1-yl)methyl]benzene-1-carbonyl}-N,N-dimethyl-1H-indole-1-carboxamide
OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol)
SO4 — sulfate ion
ZN — zinc ion
8 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 1 extra chains, 85 C-terminal residues, 214 N-terminal residues, 16
non-polymer residues more than 3.0 Angstroms away.
Alignment of 5zkq chain B to query has RMSD 1.08 using 44 of 92 paired
residues within cutoff distance 2.0
3bkv title:
X-ray structure of the bacteriophage phiKZ lytic transglycosylase, gp144, in
complex with chitotetraose, (NAG)4 [more info...]
Chain information for 3bkv #396
---
Chain | Description | UniProt
A | lytic transglycosylase | Q8SD18_9CAUD 1-260
Non-standard residues in 3bkv #396
---
NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine;
2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose;
2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE)
NI — nickel (II) ion
SO4 — sulfate ion
Deleted 4 C-terminal residues, 114 N-terminal residues, 6 non-polymer residues
more than 3.0 Angstroms away.
Alignment of 3bkv chain A to query has RMSD 1.21 using 33 of 121 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 4dqj from http://files.rcsb.org/download/4dqj.cif
Fetching CCD AES from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/S/AES/AES.cif
4dqj title:
Structural Investigation of Bacteriophage Phi6 Lysin (in complex with
chitotetraose) [more info...]
Chain information for 4dqj #397
---
Chain | Description | UniProt
A B | Membrane protein Phi6 P5 | Q283U5_BPPH6 48-220
Non-standard residues in 4dqj #397
---
AES — 4-(2-aminoethyl)benzenesulfonyl fluoride (AEBSF)
NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine;
2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose;
2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE)
4dqj mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
62 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
2723 atoms have anisotropic B-factors. Depict anisotropic information with
Thermal Ellipsoids [start tool...] or the aniso command.
Deleted 1 extra chains, 4 C-terminal residues, 3 N-terminal residues, 306 non-
polymer residues more than 3.0 Angstroms away.
Alignment of 4dqj chain A to query has RMSD 1.38 using 28 of 112 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 4eya from http://files.rcsb.org/download/4eya.cif
4eya title:
Crystal Structure of a Plectonemic RNA Supercoil [more info...]
Chain information for 4eya #398
---
Chain | Description | UniProt
A B C D E F G H | N utilization substance protein B homolog | NUSB_AQUAE 1-148
a b c d e f g h i j k l m n o p q r s t | RNA (5'-R(*GP*GP*CP*UP*CP*CP*UP*UP*GP*GP*CP*A)-3') |
Non-standard residues in 4eya #398
---
GOL — glycerol (glycerin; propane-1,2,3-triol)
SO4 — sulfate ion
Deleted 27 extra chains, 10 C-terminal residues, 37 N-terminal residues, 16
non-polymer residues more than 3.0 Angstroms away.
Alignment of 4eya chain A to query has RMSD 0.768 using 23 of 80 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 7ao7 from http://files.rcsb.org/download/7ao7.cif
Fetching CCD HEM from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/M/HEM/HEM.cif
Fetching CCD OC9 from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/9/OC9/OC9.cif
7ao7 title:
Structure of CYP153A from Polaromonas sp. in complex with octan-1-ol [more
info...]
Chain information for 7ao7 #399
---
Chain | Description | UniProt
A B C D E F | Cytochrome P450 | Q11ZY2_POLSJ 1-418
Non-standard residues in 7ao7 #399
---
HEM — protoporphyrin IX containing Fe (HEME)
OC9 — octan-1-ol
7ao7 mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
4| author_defined_assembly
5| author_defined_assembly
6| author_defined_assembly
Deleted 5 extra chains, 98 C-terminal residues, 163 N-terminal residues, 358
non-polymer residues more than 3.0 Angstroms away.
Alignment of 7ao7 chain B to query has RMSD 1.03 using 14 of 95 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 4ye9 from http://files.rcsb.org/download/4ye9.cif
4ye9 title:
The crystal structure of the G45V mutant of human GlnRS [more info...]
Chain information for 4ye9 #400
---
Chain | Description | UniProt
A | Glutamine--tRNA ligase | SYQ_HUMAN 1-775
28 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Deleted 612 C-terminal residues, 15 N-terminal residues, 83 non-polymer
residues more than 3.0 Angstroms away.
Alignment of 4ye9 chain A to query has RMSD 0.814 using 13 of 71 paired
residues within cutoff distance 2.0
Fetching compressed mmCIF 7uqj from http://files.rcsb.org/download/7uqj.cif
Fetching CCD AGS from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/S/AGS/AGS.cif
7uqj title:
Cryo-EM structure of the S. cerevisiae chromatin remodeler Yta7 hexamer bound
to ATPgS and histone H3 tail in state II [more info...]
Chain information for 7uqj #401
---
Chain | Description | UniProt
A B C D E F | ATPase histone chaperone YTA7 | ATAD2_YEAST 1-1379
G | Histone H3 | H3_YEAST 1-25
Non-standard residues in 7uqj #401
---
ADP — adenosine-5'-diphosphate
AGS — phosphothiophosphoric acid-adenylate ester (atp-γ-S; adenosine
5'-(3-thiotriphosphate); adenosine 5'-(γ-thiotriphosphate);
adenosine-5'-diphosphate monothiophosphate)
MG — magnesium ion
Deleted 6 extra chains, 315 C-terminal residues, 181 N-terminal residues, 10
non-polymer residues more than 3.0 Angstroms away.
Alignment of 7uqj chain F to query has RMSD 1.29 using 25 of 79 paired
residues within cutoff distance 2.0
7uqj title:
Cryo-EM structure of the S. cerevisiae chromatin remodeler Yta7 hexamer bound
to ATPgS and histone H3 tail in state II [more info...]
Chain information for 7uqj #402
---
Chain | Description | UniProt
A B C D E F | ATPase histone chaperone YTA7 | ATAD2_YEAST 1-1379
G | Histone H3 | H3_YEAST 1-25
Non-standard residues in 7uqj #402
---
ADP — adenosine-5'-diphosphate
AGS — phosphothiophosphoric acid-adenylate ester (atp-γ-S; adenosine
5'-(3-thiotriphosphate); adenosine 5'-(γ-thiotriphosphate);
adenosine-5'-diphosphate monothiophosphate)
MG — magnesium ion
Deleted 6 extra chains, 309 C-terminal residues, 187 N-terminal residues, 10
non-polymer residues more than 3.0 Angstroms away.
Alignment of 7uqj chain C to query has RMSD 1.3 using 27 of 70 paired residues
within cutoff distance 2.0
Fetching compressed mmCIF 3qz1 from http://files.rcsb.org/download/3qz1.cif
Fetching CCD 3QZ from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/Z/3QZ/3QZ.cif
3qz1 title:
Crystal Structure of Bovine Steroid of 21-hydroxylase (P450c21) [more info...]
Chain information for 3qz1 #403
---
Chain | Description | UniProt
A B C D | Steroid 21-hydroxylase | CP21A_BOVIN 1-496
Non-standard residues in 3qz1 #403
---
3QZ — (9beta)-17-hydroxypregn-4-ene-3,20-dione
HEM — protoporphyrin IX containing Fe (HEME)
3qz1 mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
3| author_and_software_defined_assembly
4| author_and_software_defined_assembly
Deleted 3 extra chains, 176 C-terminal residues, 192 N-terminal residues, 108
non-polymer residues more than 3.0 Angstroms away.
Alignment of 3qz1 chain B to query has RMSD 1.04 using 15 of 67 paired
residues within cutoff distance 2.0
7uqj title:
Cryo-EM structure of the S. cerevisiae chromatin remodeler Yta7 hexamer bound
to ATPgS and histone H3 tail in state II [more info...]
Chain information for 7uqj #404
---
Chain | Description | UniProt
A B C D E F | ATPase histone chaperone YTA7 | ATAD2_YEAST 1-1379
G | Histone H3 | H3_YEAST 1-25
Non-standard residues in 7uqj #404
---
ADP — adenosine-5'-diphosphate
AGS — phosphothiophosphoric acid-adenylate ester (atp-γ-S; adenosine
5'-(3-thiotriphosphate); adenosine 5'-(γ-thiotriphosphate);
adenosine-5'-diphosphate monothiophosphate)
MG — magnesium ion
Deleted 6 extra chains, 309 C-terminal residues, 184 N-terminal residues, 10
non-polymer residues more than 3.0 Angstroms away.
Alignment of 7uqj chain E to query has RMSD 1.25 using 25 of 74 paired
residues within cutoff distance 2.0
> select clear
> close
> open "/Users/gth_book/Documents/1_JOB_Files/Research_Proj_Prop/★
> Prop_2024_Enzybiotics ▲ 🌱/Structures_Analysis/Structure
> analysis/AbLys1_8APP_monom.pdb"
Chain information for AbLys1_8APP_monom.pdb #1
---
Chain | Description
A | No description available
> ui tool show "Similar Structures"
> foldseek /A
Found 404 similar structures to AbLys1_8APP_monom.pdb #1/A in pdb database
using foldseek, name fs1
> sequence search /A
Traceback (most recent call last):
File
"/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/similarstructures/gui.py", line 239, in _search
run(self.session, cmd)
File
"/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/core/commands/run.py", line 49, in run
results = command.run(text, log=log, return_json=return_json)
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
File
"/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/core/commands/cli.py", line 3237, in run
result = ci.function(session, **kw_args)
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
File
"/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/similarstructures/mmseqs2_search.py", line 39, in
mmseqs2_search
Mmseqs2WebQuery(session, chain, database=database,
File
"/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/similarstructures/mmseqs2_search.py", line 73, in __init__
chain_hits = add_chains_descrip_species(entity_hits)
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
File
"/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/similarstructures/mmseqs2_search.py", line 206, in
add_chains_descrip_species
pdb_info = fetch_pdb_entity_info(set(entity_ids))
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
File
"/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/similarstructures/mmseqs2_search.py", line 260, in
fetch_pdb_entity_info
f = urlopen(req)
^^^^^^^^^^^^
File
"/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/urllib/request.py",
line 216, in urlopen
return opener.open(url, data, timeout)
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
File
"/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/urllib/request.py",
line 525, in open
response = meth(req, response)
^^^^^^^^^^^^^^^^^^^
File
"/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/urllib/request.py",
line 634, in http_response
response = self.parent.error(
^^^^^^^^^^^^^^^^^^
File
"/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/urllib/request.py",
line 563, in error
return self._call_chain(*args)
^^^^^^^^^^^^^^^^^^^^^^^
File
"/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/urllib/request.py",
line 496, in _call_chain
result = func(*args)
^^^^^^^^^^^
File
"/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/urllib/request.py",
line 643, in http_error_default
raise HTTPError(req.full_url, code, msg, hdrs, fp)
urllib.error.HTTPError: HTTP Error 415: Unsupported Media Type
urllib.error.HTTPError: HTTP Error 415: Unsupported Media Type
File
"/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/urllib/request.py",
line 643, in http_error_default
raise HTTPError(req.full_url, code, msg, hdrs, fp)
See log for complete Python traceback.
OpenGL version: 4.1 Metal - 90.5
OpenGL renderer: Apple M1 Pro
OpenGL vendor: Apple
Python: 3.11.9
Locale: en_US.UTF-8
Qt version: PyQt6 6.9.1, Qt 6.9.0
Qt runtime version: 6.9.2
Qt platform: cocoa
Hardware:
Hardware Overview:
Model Name: MacBook Pro
Model Identifier: MacBookPro18,1
Model Number: Z14Y000JEY/A
Chip: Apple M1 Pro
Total Number of Cores: 10 (8 Performance and 2 Efficiency)
Memory: 16 GB
System Firmware Version: 18000.120.36
OS Loader Version: 18000.120.36
Software:
System Software Overview:
System Version: macOS 26.5 (25F71)
Kernel Version: Darwin 25.5.0
Time since boot: 14 hours, 30 minutes
Graphics/Displays:
Apple M1 Pro:
Chipset Model: Apple M1 Pro
Type: GPU
Bus: Built-In
Total Number of Cores: 16
Vendor: Apple (0x106b)
Metal Support: Metal 4
Displays:
Color LCD:
Display Type: Built-in Liquid Retina XDR Display
Resolution: 3456 x 2234 Retina
Main Display: Yes
Mirror: Off
Online: Yes
Automatically Adjust Brightness: No
Connection Type: Internal
Installed Packages:
aiohappyeyeballs: 2.6.1
aiohttp: 3.13.1
aiosignal: 1.4.0
alabaster: 1.0.0
annotated-types: 0.7.0
anyio: 4.12.1
appdirs: 1.4.4
appnope: 0.1.4
asttokens: 3.0.1
attrs: 25.4.0
babel: 2.17.0
beautifulsoup4: 4.13.5
blockdiag: 3.0.0
blosc2: 3.12.2
build: 1.3.0
certifi: 2025.7.14
cftime: 1.6.5
charset-normalizer: 3.4.4
ChimeraX-AddCharge: 1.5.20
ChimeraX-AddH: 2.2.8
ChimeraX-AlignmentAlgorithms: 2.0.2
ChimeraX-AlignmentHdrs: 3.6.1
ChimeraX-AlignmentMatrices: 2.1
ChimeraX-Alignments: 3.1.1
ChimeraX-AlphaFold: 1.0.1
ChimeraX-AltlocExplorer: 1.2
ChimeraX-AmberInfo: 1.0
ChimeraX-Animations: 1.0
ChimeraX-Aniso: 1.3.2
ChimeraX-Arrays: 1.1
ChimeraX-Atomic: 1.61.4
ChimeraX-AtomicLibrary: 14.2.1
ChimeraX-AtomSearch: 2.0.1
ChimeraX-AxesPlanes: 2.4
ChimeraX-BasicActions: 1.1.3
ChimeraX-BILD: 1.0
ChimeraX-BlastProtein: 3.0.0
ChimeraX-Boltz: 1.1
ChimeraX-BondRot: 2.0.4
ChimeraX-BugReporter: 1.0.2
ChimeraX-BuildStructure: 2.13.1
ChimeraX-Bumps: 1.0
ChimeraX-BundleBuilder: 1.6.0
ChimeraX-ButtonPanel: 1.0.1
ChimeraX-CageBuilder: 1.0.1
ChimeraX-CellPack: 1.0
ChimeraX-Centroids: 1.4
ChimeraX-ChangeChains: 1.1
ChimeraX-CheckWaters: 1.5
ChimeraX-ChemGroup: 2.0.2
ChimeraX-CiliaBuilder: 1.1.0
ChimeraX-Clashes: 2.3
ChimeraX-Clipper: 0.26.1
ChimeraX-clix: 0.2.7
ChimeraX-ColorActions: 1.0.5
ChimeraX-ColorGlobe: 1.0
ChimeraX-ColorKey: 1.5.8
ChimeraX-CommandLine: 1.3.0
ChimeraX-ConnectStructure: 2.0.1
ChimeraX-Contacts: 1.0.1
ChimeraX-Core: 1.11.1
ChimeraX-CoreFormats: 1.2
ChimeraX-coulombic: 1.4.5
ChimeraX-Crosslinks: 1.0
ChimeraX-Crystal: 1.0
ChimeraX-CrystalContacts: 1.0.1
ChimeraX-DAQplugin: 1.0.1
ChimeraX-DataFormats: 1.2.4
ChimeraX-Dicom: 1.2.7
ChimeraX-DistMonitor: 1.4.2
ChimeraX-DockPrep: 1.1.4
ChimeraX-Dssp: 2.0
ChimeraX-EMDB-SFF: 1.0
ChimeraX-ESMFold: 1.0
ChimeraX-FileHistory: 1.0.1
ChimeraX-FunctionKey: 1.0.1
ChimeraX-Geometry: 1.3
ChimeraX-gltf: 1.0
ChimeraX-Graphics: 1.4.1
ChimeraX-Hbonds: 2.5.3
ChimeraX-Help: 1.3
ChimeraX-HKCage: 1.3
ChimeraX-IHM: 1.1
ChimeraX-ImageFormats: 1.2
ChimeraX-IMOD: 1.0
ChimeraX-IO: 1.0.4
ChimeraX-ItemsInspection: 1.0.1
ChimeraX-IUPAC: 1.0
ChimeraX-KVFinder: 1.7.3
ChimeraX-Label: 1.2
ChimeraX-ListInfo: 1.2.2
ChimeraX-Log: 1.2.2
ChimeraX-LookingGlass: 1.1
ChimeraX-Maestro: 1.9.2
ChimeraX-Map: 1.3
ChimeraX-MapData: 2.0
ChimeraX-MapEraser: 1.0.1
ChimeraX-MapFilter: 2.0.1
ChimeraX-MapFit: 2.0
ChimeraX-MapSeries: 2.1.1
ChimeraX-Markers: 1.0.1
ChimeraX-Mask: 1.0.2
ChimeraX-MatchMaker: 2.2.2
ChimeraX-MCopy: 1.0
ChimeraX-MCPServer: 0.1.0
ChimeraX-MDcrds: 2.17.2
ChimeraX-MedicalToolbar: 1.1
ChimeraX-Meeting: 1.0.1
ChimeraX-Minimize: 1.3.2
ChimeraX-MLP: 1.1.1
ChimeraX-mmCIF: 2.16
ChimeraX-MMTF: 2.2
ChimeraX-ModelArchive: 1.0
ChimeraX-Modeller: 1.5.22
ChimeraX-ModelPanel: 1.6
ChimeraX-ModelSeries: 1.0.1
ChimeraX-Mol2: 2.0.3
ChimeraX-Mole: 1.0
ChimeraX-Morph: 1.0.2
ChimeraX-MouseModes: 1.2
ChimeraX-Movie: 1.0.1
ChimeraX-MutationScores: 1.0
ChimeraX-Neuron: 1.0
ChimeraX-Nifti: 1.2
ChimeraX-NIHPresets: 1.2.8
ChimeraX-NMRSTAR: 1.0.2
ChimeraX-NRRD: 1.2
ChimeraX-Nucleotides: 2.0.3
ChimeraX-OpenCommand: 1.15.2
ChimeraX-OrthoPick: 1.0.1
ChimeraX-PDB: 2.7.12
ChimeraX-PDBBio: 1.0.1
ChimeraX-PDBLibrary: 1.0.5
ChimeraX-PDBMatrices: 1.0
ChimeraX-PhenixUI: 1.5.4
ChimeraX-PickBlobs: 1.0.1
ChimeraX-Positions: 1.0
ChimeraX-PresetMgr: 1.1.4
ChimeraX-ProfileGrids: 1.4.2
ChimeraX-PubChem: 2.2
ChimeraX-ReadPbonds: 1.0.1
ChimeraX-Registration: 1.1.2
ChimeraX-RemoteControl: 1.0
ChimeraX-RenderByAttr: 1.6.5
ChimeraX-RenumberResidues: 1.1
ChimeraX-ResidueFit: 1.0.1
ChimeraX-RestServer: 1.3.3
ChimeraX-RNALayout: 1.0
ChimeraX-RotamerLibMgr: 4.0
ChimeraX-RotamerLibsDunbrack: 2.0
ChimeraX-RotamerLibsDynameomics: 2.0
ChimeraX-RotamerLibsRichardson: 2.0
ChimeraX-SaveCommand: 1.5.2
ChimeraX-Scenes: 0.3.1
ChimeraX-SchemeMgr: 1.0
ChimeraX-SDF: 2.0.3
ChimeraX-Segger: 1.0
ChimeraX-Segment: 1.0.1
ChimeraX-Segmentations: 3.5.10
ChimeraX-SelInspector: 1.0
ChimeraX-SeqView: 2.17.3
ChimeraX-Shape: 1.1
ChimeraX-Shell: 1.0.1
ChimeraX-Shortcuts: 1.2.1
ChimeraX-ShowSequences: 1.0.3
ChimeraX-SideView: 1.0.1
ChimeraX-SimilarStructures: 1.0.1
ChimeraX-Smiles: 2.1.2
ChimeraX-SmoothLines: 1.0
ChimeraX-SpaceNavigator: 1.0
ChimeraX-StdCommands: 1.19.1
ChimeraX-STL: 1.0.1
ChimeraX-Storm: 1.0
ChimeraX-StructMeasure: 1.2.1
ChimeraX-Struts: 1.0.1
ChimeraX-Surface: 1.0.1
ChimeraX-SwapAA: 2.0.1
ChimeraX-SwapRes: 2.5.2
ChimeraX-TapeMeasure: 1.0
ChimeraX-TaskManager: 1.0
ChimeraX-Test: 1.0
ChimeraX-Toolbar: 1.2.3
ChimeraX-ToolshedUtils: 1.2.4
ChimeraX-Topography: 1.0
ChimeraX-ToQuest: 1.0
ChimeraX-Tug: 1.0.1
ChimeraX-UI: 1.49.1
ChimeraX-Umap: 1.0
ChimeraX-uniprot: 2.3.2
ChimeraX-UnitCell: 1.0.1
ChimeraX-ViewDock: 1.5.2
ChimeraX-VIPERdb: 1.0
ChimeraX-Vive: 1.1
ChimeraX-VolumeMenu: 1.0.1
ChimeraX-vrml: 1.0
ChimeraX-VTK: 1.0
ChimeraX-WavefrontOBJ: 1.0
ChimeraX-WebCam: 1.0.2
ChimeraX-WebServices: 1.1.5
ChimeraX-Zone: 1.0.1
click: 8.3.1
colorama: 0.4.6
coloredlogs: 15.0.1
comm: 0.2.3
contourpy: 1.3.3
coverage: 7.13.1
cxservices: 1.2.3
cycler: 0.12.1
Cython: 3.1.4
debugpy: 1.8.19
decorator: 5.2.1
docutils: 0.21.2
executing: 2.2.1
filelock: 3.19.1
flatbuffers: 25.12.19
fonttools: 4.61.1
frozenlist: 1.8.0
funcparserlib: 2.0.0a0
glfw: 2.10.0
grako: 3.16.5
h11: 0.16.0
h5py: 3.15.1
html2text: 2025.4.15
httpcore: 1.0.9
httpx: 0.28.1
httpx-sse: 0.4.3
humanfriendly: 10.0
idna: 3.11
ihm: 2.2
imagecodecs: 2024.6.1
imagesize: 1.4.1
iniconfig: 2.3.0
ipykernel: 6.30.1
ipython: 9.5.0
ipython_pygments_lexers: 1.1.1
ipywidgets: 8.1.8
jedi: 0.19.2
Jinja2: 3.1.6
joblib: 1.5.3
jsonschema: 4.26.0
jsonschema-specifications: 2025.9.1
jupyter_client: 8.6.3
jupyter_core: 5.9.1
jupyterlab_widgets: 3.0.16
kiwisolver: 1.4.9
line_profiler: 5.0.0
llvmlite: 0.46.0
lxml: 6.0.2
lz4: 4.3.2
Markdown: 3.8.2
MarkupSafe: 3.0.3
matplotlib: 3.10.7
matplotlib-inline: 0.2.1
mcp: 1.18.0
MolecularDynamicsViewer: 1.6
mpmath: 1.3.0
mrcfile: 1.5.4
msgpack: 1.1.1
multidict: 6.7.0
ndindex: 1.10.1
nest-asyncio: 1.6.0
netCDF4: 1.6.5
networkx: 3.3
nibabel: 5.2.0
nptyping: 2.5.0
numba: 0.64.0
numexpr: 2.14.1
numpy: 1.26.4
onnxruntime: 1.23.2
OpenMM: 8.2.0
openvr: 1.26.701
packaging: 25.0
pandas: 3.0.0
ParmEd: 4.2.2
parso: 0.8.5
pep517: 0.13.1
pexpect: 4.9.0
pickleshare: 0.7.5
pillow: 11.3.0
pip: 25.2
pkginfo: 1.12.1.2
platformdirs: 4.5.1
pluggy: 1.6.0
prompt_toolkit: 3.0.52
propcache: 0.4.1
protobuf: 6.33.5
psutil: 7.0.0
ptyprocess: 0.7.0
pure_eval: 0.2.3
py-cpuinfo: 9.0.0
pybind11: 3.0.1
pycollada: 0.8
pydantic: 2.12.5
pydantic-settings: 2.12.0
pydantic_core: 2.41.5
pydicom: 2.4.4
Pygments: 2.18.0
pynmrstar: 3.3.6
pynndescent: 0.6.0
pynrrd: 1.0.0
PyOpenGL: 3.1.10
PyOpenGL-accelerate: 3.1.10
pyopenxr: 1.1.4501
pyparsing: 3.3.2
pyproject_hooks: 1.2.0
PyQt6-commercial: 6.9.1
PyQt6-Qt6: 6.9.2
PyQt6-WebEngine-commercial: 6.9.0
PyQt6-WebEngine-Qt6: 6.9.2
PyQt6_sip: 13.10.2
pytest: 9.0.2
pytest-cov: 7.0.0
python-dateutil: 2.9.0.post0
python-dotenv: 1.2.1
python-multipart: 0.0.21
pyzmq: 27.1.0
qtconsole: 5.7.0
QtPy: 2.4.3
qtshim: 1.2
RandomWords: 0.4.0
referencing: 0.37.0
requests: 2.32.5
roman-numerals: 4.1.0
roman-numerals-py: 4.1.0
rpds-py: 0.30.0
scikit-learn: 1.8.0
scipy: 1.17.0
scipy: 1.14.0
Send2Trash: 2.1.0
SEQCROW: 1.9.7
setuptools: 80.9.0
sfftk-rw: 0.8.1
six: 1.17.0
snowballstemmer: 3.0.1
sortedcontainers: 2.4.0
soupsieve: 2.8.3
Sphinx: 8.2.3
sphinx-autodoc-typehints: 3.2.0
sphinxcontrib-applehelp: 2.0.0
sphinxcontrib-blockdiag: 3.0.0
sphinxcontrib-devhelp: 2.0.0
sphinxcontrib-htmlhelp: 2.1.0
sphinxcontrib-jsmath: 1.0.1
sphinxcontrib-qthelp: 2.0.0
sphinxcontrib-serializinghtml: 2.0.0
sse-starlette: 3.2.0
stack-data: 0.6.3
starlette: 0.52.1
superqt: 0.7.6
sympy: 1.14.0
tables: 3.10.2
tcia_utils: 1.5.1
threadpoolctl: 3.6.0
tifffile: 2025.3.13
tinyarray: 1.2.5
tornado: 6.5.4
tqdm: 4.67.3
traitlets: 5.14.3
typing-inspection: 0.4.2
typing_extensions: 4.15.0
umap-learn: 0.5.11
urllib3: 2.6.3
uvicorn: 0.40.0
wcwidth: 0.3.2
webcolors: 24.11.1
wheel: 0.45.1
wheel-filename: 1.4.2
widgetsnbextension: 4.0.15
yarl: 1.22.0
Note:
See TracTickets
for help on using tickets.
