Opened 6 months ago

Closed 6 months ago

#19319 closed defect (fixed)

AlphaFold JSON drag and drop: pae_path is None

Reported by: chimerax-bug-report@… Owned by: Tom Goddard
Priority: normal Milestone:
Component: Structure Prediction Version:
Keywords: Cc:
Blocked By: Blocking:
Notify when closed: Platform: all
Project: ChimeraX

Description

The following bug report has been submitted:
Platform:        macOS-15.6.1-arm64-arm-64bit
ChimeraX Version: 1.10.1 (2025-07-24 20:15:27 UTC)
Description
opening the .json full data file (PAE data) that matches the model that i have open. downloaded from alphafold3

Log:
UCSF ChimeraX version: 1.10.1 (2025-07-24)  
© 2016-2025 Regents of the University of California. All rights reserved.  
How to cite UCSF ChimeraX  

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-FL_PSD95-FL/fold_full_length_par3_and_psd95_model_0.cif

Chain information for fold_full_length_par3_and_psd95_model_0.cif #1  
---  
Chain | Description  
A | .  
B | .  
  
Computing secondary structure  

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-FL_PSD95-FL/fold_full_length_par3_and_psd95_full_data_0.json

Opened AlphaFold PAE with values for 1990 residues and atoms  

> color bychain

> alphafold contacts /A toAtoms /B 8

Expected a keyword  

> hide (protein & @bfactor<70)

Expected a collection of one of 'atoms', 'bonds', 'cartoons', 'models',
'pbonds', 'pseudobonds', 'ribbons', or 'surfaces' or a keyword  

> contacts

6959 contacts  

> ~hbonds

> close #1.1

> alphafold contacts /A toAtoms /B maxPae 5

Found 3 residue or atom pairs within distance 3 with pae <= 5  

> interfaces ~solvent

1 buried areas: A B 9107  

> alphafold contacts /A toAtoms /B maxPae 10

Found 22 residue or atom pairs within distance 3 with pae <= 10  

> alphafold contacts /A toAtoms /B maxPae 10

Found 17 residue or atom pairs within distance 3 with pae <= 10  

> alphafold contacts /A toAtoms /B maxPae 10 outputFile
> /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-FL_PSD95-FL/contacts-
> AtoB-maxPae10

Found 17 residue or atom pairs within distance 3 with pae <= 10  

> alphafold contacts /A toAtoms /B maxPae 5 outputFile
> /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-FL_PSD95-FL/contacts-
> AtoB-maxPae5

Found 3 residue or atom pairs within distance 3 with pae <= 5  

> alphafold contacts /B toAtoms /A maxPae 5 outputFile
> /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-FL_PSD95-FL/contacts-
> BtoA-maxPae5

Found 0 residue or atom pairs within distance 3 with pae <= 5  

> alphafold contacts /B toAtoms /A maxPae 10

Found 11 residue or atom pairs within distance 3 with pae <= 10  

> alphafold contacts /A toAtoms /B maxPae 5

Found 3 residue or atom pairs within distance 3 with pae <= 5  

> show sel surfaces

[Repeated 1 time(s)]

> help help:user/commands/interfaces.html#diagram

> hide #1.2 models

> hide #1.3 models

> select subtract #1.2

1459 atoms, 172 residues, 3 models selected  

> select subtract #1.3

1 model selected  

> show cartoons

> hide surfaces

[Repeated 1 time(s)]

> ~hbonds

> hide atoms

> show #1.2 models

> hide #1.2 models

> hide atoms

> hide surfaces

> show cartoons

> hide #1.1 models

> show #1.1 models

> color (#!1 & sel) magenta

> select subtract #1.2

1 model selected  

> color (#!1 & sel) cyan

> color (#!1 & sel) dim gray

> color (#!1 & sel) white

> select subtract #1.3

1 model selected  

> show #1.3 models

> hide #1.3 models

> select add #1.3

5672 atoms, 724 residues, 1 model selected  

> select subtract #1.3

1 model selected  

> select add #1.2

9913 atoms, 1266 residues, 1 model selected  

> select subtract #1.2

1 model selected  

> color #1.2 #ff00ff3e

> color #1.2 #ff00ffa8

> show #1.2 models

> color #1 #ff00ff80

> color #1 magenta

[Repeated 1 time(s)]

> color #1.1 #f7d0d8ff models

> close #1.2

> close

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-FL_PSD95-FL/fold_full_length_par3_and_psd95_full_data_0.json
> format pae

Opening an AlphaFold PAE file requires first opening the predicted atomic
model. Did not find an open atomic model from the same directory. If the
atomic model is already open choose it using menu  
  
Tools / Structure Prediction / AlphaFold Error Plot  
  
or use the open command structure option, for example  
  
open /Users/hannacaiola/Library/CloudStorage/Box-
Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-FL_PSD95-FL/fold_full_length_par3_and_psd95_full_data_0.json
structure #1  
  
If you are trying to open a JSON file that is not AlphaFold PAE data then you
need to specify the specific JSON format such as  
  
open mole_channels.json format mole  

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-FL_PSD95-FL/fold_full_length_par3_and_psd95_model_0.cif
> format mmcif

Chain information for fold_full_length_par3_and_psd95_model_0.cif #1  
---  
Chain | Description  
A | .  
B | .  
  
Computing secondary structure  

> alphafold contacts /A toAtoms /B maxPae 5

Structure fold_full_length_par3_and_psd95_model_0.cif #1 does not have PAE
data opened  

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-FL_PSD95-FL/fold_full_length_par3_and_psd95_full_data_0.json

Opened AlphaFold PAE with values for 1990 residues and atoms  

> alphafold contacts /A toAtoms /B maxPae 5

Found 3 residue or atom pairs within distance 3 with pae <= 5  

> ui tool show ViewDockX

No suitable models found for ViewDockX  

> ui tool show "Find Cavities"

> kvfinder replace false

77 cavities found for fold_full_length_par3_and_psd95_model_0.cif #1  
fold_full_length_par3_and_psd95_model_0.cif Cavities  
---  
ID |  | Volume | Area | Points | Maximum  
Depth | Average  
Depth  
1.2.7 |  | 7742.3 | 5073.72 | 35844 | 9.69 | 2.43  
1.2.57 |  | 2500.85 | 1746.59 | 11578 | 7.85 | 2.35  
1.2.24 |  | 816.48 | 566.87 | 3780 | 5.97 | 1.85  
1.2.46 |  | 761.62 | 567.23 | 3526 | 8.76 | 2.5  
1.2.64 |  | 623.16 | 647.23 | 2885 | 9.62 | 3.22  
1.2.49 |  | 538.7 | 379.21 | 2494 | 7.4 | 1.31  
1.2.17 |  | 242.14 | 261.02 | 1121 | 6.21 | 2.36  
1.2.66 |  | 231.98 | 157.58 | 1074 | 4.02 | 1.24  
1.2.59 |  | 216 | 140.91 | 1000 | 2.68 | 0.68  
1.2.38 |  | 178.63 | 151.85 | 827 | 2.55 | 0.66  
1.2.4 |  | 162.65 | 142.84 | 753 | 3 | 0.89  
1.2.65 |  | 158.11 | 148.43 | 732 | 1.7 | 0.42  
1.2.74 |  | 135.65 | 139.9 | 628 | 4.8 | 1.59  
1.2.52 |  | 89.42 | 106.04 | 414 | 0 | 0  
1.2.61 |  | 85.97 | 94.17 | 398 | 3 | 0.89  
1.2.6 |  | 68.26 | 92.92 | 316 | 0 | 0  
1.2.1 |  | 65.66 | 58.62 | 304 | 2.47 | 0.71  
1.2.5 |  | 65.23 | 63.54 | 302 | 1.47 | 0.41  
1.2.44 |  | 61.13 | 87.02 | 283 | 0 | 0  
1.2.27 |  | 55.08 | 72.37 | 255 | 3.55 | 1.28  
1.2.55 |  | 49.46 | 62.04 | 229 | 3.65 | 1.29  
1.2.47 |  | 44.93 | 47.9 | 208 | 2.16 | 0.59  
1.2.56 |  | 42.77 | 52.03 | 198 | 3.45 | 1.35  
1.2.3 |  | 42.12 | 60.5 | 195 | 1.9 | 0.42  
1.2.75 |  | 34.34 | 20.47 | 159 | 1.2 | 0.24  
1.2.60 |  | 33.26 | 54.73 | 154 | 1.34 | 0.29  
1.2.71 |  | 28.51 | 32.27 | 132 | 1.8 | 0.48  
1.2.31 |  | 28.3 | 43.5 | 131 | 3.23 | 1.44  
1.2.62 |  | 28.3 | 52.36 | 131 | 2.16 | 0.8  
1.2.19 |  | 28.08 | 38.26 | 130 | 1.04 | 0.23  
1.2.50 |  | 25.7 | 39.21 | 119 | 1.34 | 0.39  
1.2.11 |  | 25.27 | 44.31 | 117 | 3.23 | 1.33  
1.2.40 |  | 25.06 | 31.26 | 116 | 1.2 | 0.21  
1.2.69 |  | 24.62 | 45.81 | 114 | 0 | 0  
1.2.23 |  | 22.9 | 41.28 | 106 | 0 | 0  
1.2.76 |  | 22.03 | 29.76 | 102 | 1.8 | 0.53  
1.2.53 |  | 21.82 | 28.73 | 101 | 1.7 | 0.63  
1.2.45 |  | 21.6 | 39.67 | 100 | 2.24 | 0.91  
1.2.28 |  | 20.74 | 41.19 | 96 | 0 | 0  
1.2.41 |  | 20.74 | 35.61 | 96 | 2.4 | 0.86  
1.2.33 |  | 20.52 | 36.87 | 95 | 2.16 | 0.67  
1.2.25 |  | 19.66 | 22.57 | 91 | 1.47 | 0.43  
1.2.18 |  | 19.01 | 38.34 | 88 | 0 | 0  
1.2.9 |  | 17.28 | 36.68 | 80 | 0 | 0  
1.2.63 |  | 16.85 | 32.3 | 78 | 0 | 0  
1.2.39 |  | 16.63 | 16.71 | 77 | 0.6 | 0.08  
1.2.2 |  | 16.2 | 30.37 | 75 | 0.85 | 0.21  
1.2.21 |  | 15.98 | 22.95 | 74 | 1.34 | 0.44  
1.2.15 |  | 15.77 | 15.33 | 73 | 0.85 | 0.17  
1.2.68 |  | 15.34 | 23.78 | 71 | 1.34 | 0.31  
1.2.32 |  | 14.26 | 13.3 | 66 | 0.85 | 0.13  
1.2.42 |  | 13.18 | 13.98 | 61 | 0.6 | 0.13  
1.2.36 |  | 12.74 | 15.83 | 59 | 0.6 | 0.18  
1.2.13 |  | 12.31 | 29.54 | 57 | 0 | 0  
1.2.29 |  | 12.31 | 29.54 | 57 | 0 | 0  
1.2.30 |  | 12.31 | 17.49 | 57 | 0.6 | 0.09  
1.2.37 |  | 12.31 | 29.54 | 57 | 0 | 0  
1.2.51 |  | 12.31 | 29.54 | 57 | 0 | 0  
1.2.54 |  | 12.31 | 29.54 | 57 | 0 | 0  
1.2.67 |  | 12.31 | 29.54 | 57 | 0 | 0  
1.2.70 |  | 12.31 | 22.36 | 57 | 1.8 | 0.69  
1.2.77 |  | 12.31 | 18.65 | 57 | 1.34 | 0.37  
1.2.58 |  | 12.1 | 20.55 | 56 | 1.2 | 0.43  
1.2.16 |  | 11.88 | 27.62 | 55 | 2.16 | 1.18  
1.2.8 |  | 10.58 | 19.36 | 49 | 0.6 | 0.18  
1.2.43 |  | 10.37 | 23.28 | 48 | 1.7 | 0.74  
1.2.12 |  | 9.07 | 17.94 | 42 | 0.85 | 0.28  
1.2.10 |  | 8.42 | 13.39 | 39 | 0.6 | 0.06  
1.2.73 |  | 8.21 | 19.1 | 38 | 0.6 | 0.16  
1.2.20 |  | 7.78 | 16.64 | 36 | 0.6 | 0.07  
1.2.35 |  | 7.34 | 15.78 | 34 | 1.2 | 0.36  
1.2.22 |  | 6.91 | 16.54 | 32 | 0.6 | 0.11  
1.2.34 |  | 6.48 | 12.95 | 30 | 0.6 | 0.16  
1.2.14 |  | 6.26 | 15.73 | 29 | 0.85 | 0.41  
1.2.26 |  | 5.62 | 10.44 | 26 | 0.6 | 0.09  
1.2.48 |  | 5.62 | 11.34 | 26 | 0.6 | 0.18  
1.2.72 |  | 5.18 | 12.28 | 24 | 0.85 | 0.37  
  

Populating font family aliases took 60 ms. Replace uses of missing font family
"Times" with one that exists to avoid this cost.  

> color bychain

> close #1.2

> show atoms

> hide atoms

> interfaces ~solvent

1 buried areas: A B 9107  

> show sel surfaces

> hide #1.2 models

> show #1.2 models

> hide #1.2 models

> show #1.2 models

> color (#!1 & sel) light gray

> select subtract #1.2

1 model selected  

Color zone shortcut requires 1 displayed atomic model and 1 map, got 1 atomic
models, 0 maps.  

> view orient

> ui tool show "Side View"

> color #1.1 #2ceb00ff models

> color #1.1 #30ff00ff models

> hide #1.2 models

> select add #1.2

9913 atoms, 1266 residues, 1 model selected  

> set bgColor white

> color #1.2 #ff40ffff

> color (#!1 & sel) magenta

> color #1.2 #00fdffff

> color sel cyan

> select add #1

15585 atoms, 15884 bonds, 3 pseudobonds, 1990 residues, 2 models selected  

> select subtract #1

1 model selected  

> close #1.2

> set bgColor gray

> select add #1.1

3 pseudobonds, 1 model selected  

> select subtract #1.1

Nothing selected  

> view orient

> hide #1.1 models

> show #1.1 models

> hide #1.1 models

> show #1.1 models

> hide #1.1 models

> show #1.1 models

> coulombic

Using Amber 20 recommended default charges and atom types for standard
residues  
Coulombic values for fold_full_length_par3_and_psd95_model_0.cif_A SES surface
#1.2: minimum, -19.12, mean -0.58, maximum 15.01  
Coulombic values for fold_full_length_par3_and_psd95_model_0.cif_B SES surface
#1.3: minimum, -18.22, mean -2.77, maximum 17.37  
To also show corresponding color key, enter the above coulombic command and
add key true  

> view orient

> hide #1.1 models

> show #1.1 models

> view orient

> hide #1.2 models

> hide #1.3 models

> set bgColor white

> color (#!1 & sel) purple

> color (#!1 & sel) cornflower blue

> color (#!1 & sel) medium blue

> color (#!1 & sel) forest green

> color (#!1 & sel) purple

> color (#!1 & sel) cornflower blue

> color (#!1 & sel) forest green

> color #1.1 #ff9300ff models

> hide #1.1 models

> show #1.1 models

> alphafold contacts /A toAtoms /B maxPae 5 radius 5

Found 0 residue or atom pairs within distance 3 with pae <= 5  

> alphafold contacts /A toAtoms /B maxPae 5 radius 5

Found 0 residue or atom pairs within distance 3 with pae <= 5  

> alphafold contacts /A toAtoms /B maxPae 5

Found 3 residue or atom pairs within distance 3 with pae <= 5  

> view orient

> alphafold contacts /A toAtoms /B maxPae 5 radius 5

Found 3 residue or atom pairs within distance 3 with pae <= 5  

> alphafold contacts /A toAtoms /B maxPae 5 radius 2

Found 3 residue or atom pairs within distance 3 with pae <= 5  

> alphafold contacts /A toAtoms /B maxPae 5 radius 1

Found 3 residue or atom pairs within distance 3 with pae <= 5  

> alphafold contacts /A toAtoms /B maxPae 5 radius .75

Found 3 residue or atom pairs within distance 3 with pae <= 5  

> alphafold contacts /A toAtoms /B maxPae 5 radius .2

Found 3 residue or atom pairs within distance 3 with pae <= 5  

> alphafold contacts /A toAtoms /B maxPae 5 radius .5

Found 3 residue or atom pairs within distance 3 with pae <= 5  

> select clear

> color #1.1 #ff9300ff models

> color #1.1 #76d6ffff models

> color #1.1 #73fdffff models

> color #1.1 #0433ffff models

> color #1.1 #ff2600ff models

> color #1.1 #ff9300ff models

> color #1.1 #ff7e79ff models

> color #1.1 #ff9300ff models

> color #1.1 #ff7e79ff models

> color #1.1 #ff9300ff models

> view orient

> toolshed show

> label #1.1#!1 text "{0.name} {0.number}{0.insertion_code}"

> close #1.4

> ui tool show "Show Sequence Viewer"

> sequence chain /A

Alignment identifier is 1/A  

> select
> /A:23-37,65-67,129-133,224-227,267-270,293-305,316-337,454-458,480-489,540-542,572-576,598-609,677-680,801-812,827-829,833-842,908-910,912-925,930-934,960-998,1060-1076,1115-1121,1123-1128,1187-1208,1249-1254

2082 atoms, 2075 bonds, 249 residues, 1 model selected  

> select subtract #1.2

1 model selected  

> ui mousemode right "link markers"

[Repeated 2 time(s)]

> view orient

> ribscale 1.5

Unknown command: ribscale 1.5  

Unsupported scale factor (0.000000) detected on Display1  

[Repeated 3 time(s)]

> ui mousemode right translate

> ui mousemode right zoom

> show #1.2 models

> show #1.3 models

> hide #1.2 models

> hide #1.3 models

> alphafold contacts /A toAtoms /B maxPae 10 radius .5

Found 17 residue or atom pairs within distance 3 with pae <= 10  

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-E_PSD95-C/fold_par3c_e_and_psd95_c_term_model_0.cif

Chain information for fold_par3c_e_and_psd95_c_term_model_0.cif #2  
---  
Chain | Description  
A | .  
B | .  
  
Computing secondary structure  

> hide #!1 models

> hide #1.1 models

> color #2 bychain

> alphafold contacts /A toAtoms /B maxPae 5 radius .5

Interface PAE pseudobonds can only be computed for a single structure, got 2.  

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-E_PSD95-C/fold_par3c_e_and_psd95_c_term_full_data_0.json

Opened AlphaFold PAE with values for 960 residues and atoms  

> color #2/A:55 lime

> color #2/B:168 magenta

> alphafold contacts /A toAtoms /B maxPae 10 radius .5

Interface PAE pseudobonds can only be computed for a single structure, got 2.  

> close #1

> alphafold contacts /A toAtoms /B maxPae 10 radius .5

Found 5 residue or atom pairs within distance 3 with pae <= 10  

> color bychain

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-E_PSD95-N/fold_par3c_e_and_psd95_n_term_model_0.cif

Chain information for fold_par3c_e_and_psd95_n_term_model_0.cif #1  
---  
Chain | Description  
A | .  
B | .  
  
Computing secondary structure  

> hide #1 models

> close #2

> show #1 models

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-E_PSD95-N/fold_par3c_e_and_psd95_n_term_full_data_0.json

Opened AlphaFold PAE with values for 1058 residues and atoms  

> alphafold contacts /A toAtoms /B maxPae 10 radius .5

Found 6 residue or atom pairs within distance 3 with pae <= 10  

> color bychain

> show atoms

> hide atoms

> close #1

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-E_PSD95-FL/fold_par3c_e_and_full_length_psd95_model_0.cif

Chain information for fold_par3c_e_and_full_length_psd95_model_0.cif #1  
---  
Chain | Description  
A | .  
B | .  
  
Computing secondary structure  

> color bychain

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-E_PSD95-FL/fold_par3c_e_and_full_length_psd95_full_data_0.json

Opened AlphaFold PAE with values for 1371 residues and atoms  

> alphafold contacts /A toAtoms /B maxPae 10 radius .5

Found 4 residue or atom pairs within distance 3 with pae <= 10  

> alphafold contacts /B toAtoms /A maxPae 10 radius .5

Found 9 residue or atom pairs within distance 3 with pae <= 10  

> select /A

5672 atoms, 5789 bonds, 724 residues, 1 model selected  

> select clear

> alphafold contacts /B toAtoms /A maxPae 10 radius .5 browse

Expected a keyword  

> alphafold contacts /B toAtoms /A maxPae 10 radius .5 outputFile
> /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-E_PSD95-FL/contacts_BtoA_maxPAE10

Found 9 residue or atom pairs within distance 3 with pae <= 10  

> show atoms

> hide surfaces

> hide cartoons

> alphafold contacts /B toAtoms /A maxPae 10 radius .5

Found 9 residue or atom pairs within distance 3 with pae <= 10  

> hide atoms

> show surfaces

> lighting simple

> lighting soft

> lighting flat

> lighting simple

Color zone shortcut requires 1 displayed atomic model and 1 map, got 1 atomic
models, 0 maps.  

> coulombic

Using Amber 20 recommended default charges and atom types for standard
residues  
Coulombic values for fold_par3c_e_and_full_length_psd95_model_0.cif_A SES
surface #1.2: minimum, -35.71, mean -2.81, maximum 11.18  
Coulombic values for fold_par3c_e_and_full_length_psd95_model_0.cif_B SES
surface #1.3: minimum, -19.71, mean -0.57, maximum 16.81  
To also show corresponding color key, enter the above coulombic command and
add key true  

> color byhetero

> color bychain

> nucleotides atoms

> style nucleic stick

Changed 0 atom styles  

> hide cartoons

> hide surfaces

> show atoms

> nucleotides atoms

> style nucleic stick

Changed 0 atom styles  

> style stick

Changed 10822 atom styles  

> style sphere

Changed 10822 atom styles  

> style ball

Changed 10822 atom styles  

> nucleotides fill

> style nucleic stick

Changed 0 atom styles  

> nucleotides atoms

> style nucleic stick

Changed 0 atom styles  

> nucleotides atoms

> style nucleic stick

Changed 0 atom styles  

> nucleotides atoms

> style nucleic stick

Changed 0 atom styles  

> style ball

Changed 10822 atom styles  

> style sphere

Changed 10822 atom styles  

> style sphere

Changed 10822 atom styles  

> style stick

Changed 10822 atom styles  

> nucleotides atoms

> style nucleic stick

Changed 0 atom styles  

> nucleotides tube/slab shape box

> nucleotides ladder

> style ball

Changed 10822 atom styles  

> style sphere

Changed 10822 atom styles  

> style stick

Changed 10822 atom styles  

> nucleotides ladder

[Repeated 1 time(s)]

> nucleotides atoms

> style nucleic stick

Changed 0 atom styles  

> style ball

Changed 10822 atom styles  

> style sphere

Changed 10822 atom styles  

> style sphere

Changed 10822 atom styles  

> hide atoms

> show cartoons

> hide #1.2 models

> show #1.2 models

> hide #1.2 models

> show #1.2 models

> hide #1.3 models

> hide #1.2 models

> show #1.2 models

> hide #!1 models

> hide #1.1 models

> show #1.1 models

> hide #1.1 models

> show #1.1 models

> hide #1.2 models

> show #1.2 models

> show #1.3 models

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/Alphafold3/Par3c-E_PSD95-FL/fold_par3c_e_and_full_length_psd95_model_0.cif

Chain information for fold_par3c_e_and_full_length_psd95_model_0.cif #2  
---  
Chain | Description  
A | .  
B | .  
  
Computing secondary structure  

> hide #!1 models

> color #2 bychain

> show #2 surfaces

> volume style mesh

No volumes specified  

> transparency #2.1-2 50

> volume showOutlineBox true

No volumes specified  

> select add #2

10822 atoms, 11033 bonds, 1371 residues, 1 model selected  

> volume showOutlineBox true

No volumes specified  

> volume style mesh

No volumes specified  

> volume style mesh

No volumes specified  

> volume hide

No volumes specified  

> volume hide

No volumes specified  

> hide #!2 models

> select subtract #2

2 models selected  

> show #!1 models

> volume style image

No volumes specified  

> select add #1

10822 atoms, 11033 bonds, 9 pseudobonds, 1371 residues, 2 models selected  

> transparency sel 50

> select subtract #1

2 models selected  

> select add #1.1

9 pseudobonds, 1 model selected  

> select add #1

10822 atoms, 11033 bonds, 9 pseudobonds, 1371 residues, 2 models selected  

> select subtract #1

2 models selected  

> show #!2 models

> hide #!2 models

> show #!2 models

> hide #!2 models

> show #!2 models

> hide #2.1 models

> show #2.1 models

> hide #2.1 models

> show #2.1 models

> hide #2.2 models

> color #2.1 #7b68ee38

> color #2.1 #7b68ee52

> color #2.1 #7b68ee4d

> show #2.2 models

> color #2.2 #f080804d

> hide #2.2 models

> hide #!1 models

> show #!1 models

> hide #!1 models

> show #!1 models

> hide #!1 models

> show #!1 models

> hide #!1 models

> show #!1 models

> hide #1.1 models

> show #1.1 models

> hide #1.2 models

> hide #1.3 models

> hide #!1 models

> hide #!2 models

> show #!2 models

> hide #2.1 models

> show #2.1 models

> hide #2.1 models

> show #2.1 models

> hide #2.1 models

> show #2.1 models

> hide #2.1 models

> show #2.1 models

> volume hide

No volumes specified  

> volume style surface

No volumes specified  

> volume style mesh

No volumes specified  

> volume style mesh

No volumes specified  

> volume style image

No volumes specified  

> volume planes z style image imageMode "full region"

No volumes specified  

> show #!1 models

> hide #!1 models

> show #!1 models

> color #2 #7b68ee7f

> color #2 #7b68ee12

> color #2 #7b68ee00

> color #2 #7b68ee48

> color #2 mediumslateblue

> color #2 #7b68ee00

[Repeated 1 time(s)]

> color #2 #7b68ee80

> color #2 #7b68ee50

[Repeated 1 time(s)]

> color #2 #7b68ee4c

> color #2 #7b68ee4d

> color #2.1 #008f00ff

> color #2.1 #008f003b

> color #2.1 #008f0043

> color #2.1 #008f004b

> color #2.1 #008f004d

> color #2 #008f00ff

> color #2 #008f0080

> hide #!1 models

> show #!1 models

> hide #!1 models

> show #!1 models

> color #1 black

> hide #2.1 models

> hide #!2 models

> show #!2 models

> hide #!2 models

> show #!2 models

> hide #!2 models

> show #!2 models

> undo

[Repeated 9 time(s)]

> color #2.1 #9437ffff

> color #2.1 #7a81ffff

> color #2 #ebebebff

> color #2 #009193ff

> color #2 #009051ff

> color #2 #4f8f00ff

> color #2 #00fdffff

> color #2 #009051ff

> color #2 #009193ff

> hide #2.1 models

> ui tool show "Model Loops"

> ui tool show "Show Sequence Viewer"

> sequence chain #1/A #2/A

Alignment identifier is 1  

> sequence chain #1/B #2/B

Alignment identifier is 2  

> close #2

> select
> /A:61-69,77-81,94-99,116-120,143-151,157-164,172-176,189-194,211-215,238-245,312-317,325-329,336-341,357-362,385-392,431-435,459-464,470-475,485-489,523-530,537-540,598-604,607-612,646-650,690-692,715-719

1303 atoms, 1309 bonds, 157 residues, 1 model selected  

> select /B:1-45

349 atoms, 355 bonds, 45 residues, 1 model selected  

> select /B:1-569

4509 atoms, 4585 bonds, 569 residues, 1 model selected  

> select /B:604-647

357 atoms, 370 bonds, 44 residues, 1 model selected  

> select /B

5150 atoms, 5244 bonds, 647 residues, 1 model selected  

> color (#!1 & sel) #942193ff

> color (#!1 & sel) #ff40ffff

> color (#!1 & sel) #ff85ffff

> color (#!1 & sel) #ff8ad8ff

> color (#!1 & sel) #ff85ffff

> color (#!1 & sel) #f39cf9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #eba0f9ff

> color (#!1 & sel) #e4a3f9ff

> color (#!1 & sel) #dda4f9ff

> color (#!1 & sel) #daa5f9ff

> color (#!1 & sel) #d7a6f9ff

> color (#!1 & sel) #d5a6f9ff

> color (#!1 & sel) #d2a7f9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #cfa7f9ff

> color (#!1 & sel) #cda7f9ff

> color (#!1 & sel) #cba7f9ff

> color (#!1 & sel) #c9a7f9ff

> color (#!1 & sel) #c7a7f9ff

> color (#!1 & sel) #c6a6f9ff

> color (#!1 & sel) #c39ef9ff

> color (#!1 & sel) #c296f9ff

> color (#!1 & sel) #c28cf9ff

> color (#!1 & sel) #c087f9ff

> color (#!1 & sel) #bd80f9ff

> color (#!1 & sel) #bb7cf9ff

> color (#!1 & sel) #b877f9ff

> color (#!1 & sel) #b774f9ff

> color (#!1 & sel) #b571f9ff

> color (#!1 & sel) #b36bf9ff

> color (#!1 & sel) #b169f9ff

> color (#!1 & sel) #b066f9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #b166f9ff

> color (#!1 & sel) #b467f9ff

> color (#!1 & sel) #b867f9ff

> color (#!1 & sel) #bb67f9ff

> color (#!1 & sel) #bd68f9ff

> color (#!1 & sel) #bf68f9ff

> color (#!1 & sel) #c168f9ff

> color (#!1 & sel) #c46af9ff

> color (#!1 & sel) #c66af9ff

> color (#!1 & sel) #c86bf9ff

> color (#!1 & sel) #c96af9ff

> color (#!1 & sel) #ca6af9ff

> color (#!1 & sel) #cb6af9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #cc6af9ff

> color (#!1 & sel) #cf69f9ff

> color (#!1 & sel) #d069f9ff

> color (#!1 & sel) #d368f9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #d568f9ff

> color (#!1 & sel) #d567f9ff

> color (#!1 & sel) #d667f9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #d767f9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #d867f9ff

> color (#!1 & sel) #d866f9ff

> color (#!1 & sel) #d765f9ff

> color (#!1 & sel) #d663f9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #d561f9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #d660f9ff

> color (#!1 & sel) #d55ff9ff

> color (#!1 & sel) #d55ef9ff

> color (#!1 & sel) #d55df9ff

> color (#!1 & sel) #d55cf9ff

> color (#!1 & sel) #d45bf9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #d45af9ff

> color (#!1 & sel) #d459f9ff

> color (#!1 & sel) #d458f9ff

> color (#!1 & sel) #d457f9ff

> color (#!1 & sel) #d455f9ff

> color (#!1 & sel) #d454f9ff

> color (#!1 & sel) #d453f9ff

> color (#!1 & sel) #d452f9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #d451f9ff

[Repeated 2 time(s)]

> color (#!1 & sel) #d551f9ff

> color (#!1 & sel) #d753f9ff

> color (#!1 & sel) #d954f9ff

> color (#!1 & sel) #db56f9ff

> color (#!1 & sel) #df5af9ff

> color (#!1 & sel) #e25cf9ff

> color (#!1 & sel) #e65ff9ff

> color (#!1 & sel) #e861f9ff

> color (#!1 & sel) #e962f9ff

> color (#!1 & sel) #eb66f9ff

> color (#!1 & sel) #ed6bf9ff

> color (#!1 & sel) #ed6df9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #ed6ff9ff

> color (#!1 & sel) #ed70f9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #ec70f9ff

> color (#!1 & sel) #ec6ff9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #eb6ff9ff

> color (#!1 & sel) #ea6ff9ff

> color (#!1 & sel) #e86ff9ff

> color (#!1 & sel) #e770f9ff

> color (#!1 & sel) #e670f9ff

> color (#!1 & sel) #e571f9ff

> color (#!1 & sel) #e372f9ff

> color (#!1 & sel) #e272f9ff

> color (#!1 & sel) #dd74f9ff

> color (#!1 & sel) #db75f9ff

> color (#!1 & sel) #da75f9ff

> color (#!1 & sel) #d975f9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #d774f9ff

> color (#!1 & sel) #d574f9ff

> color (#!1 & sel) #d171f9ff

> color (#!1 & sel) #cd6ff9ff

> color (#!1 & sel) #c96af9ff

> color (#!1 & sel) #c765f9ff

> color (#!1 & sel) #c35ff9ff

> color (#!1 & sel) #c058f9ff

> color (#!1 & sel) #be54f9ff

> color (#!1 & sel) #bc50f9ff

[Repeated 2 time(s)]

> color (#!1 & sel) #bd53f9ff

> color (#!1 & sel) #c25cf9ff

> color (#!1 & sel) #c45ff9ff

> color (#!1 & sel) #c663f9ff

> color (#!1 & sel) #c767f9ff

> color (#!1 & sel) #c96af9ff

> color (#!1 & sel) #cc6cf9ff

> color (#!1 & sel) #cd6ef9ff

> color (#!1 & sel) #ce6ef9ff

> color (#!1 & sel) #ce6ff9ff

[Repeated 1 time(s)]

> color (#!1 & sel) #d06ef9ff

> color (#!1 & sel) #d26ef9ff

> color (#!1 & sel) #d36ef9ff

> color (#!1 & sel) #d46df9ff

[Repeated 2 time(s)]

> select /A:1

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select /A:1-477

3660 atoms, 3734 bonds, 477 residues, 1 model selected  

> select /A:1-724

5672 atoms, 5789 bonds, 724 residues, 1 model selected  

> color (#!1 & sel) #009193ff

> color (#!1 & sel) #00fdffff

> color (#!1 & sel) #73fdffff

> color (#!1 & sel) #00fdffff

> color (#!1 & sel) #0096ffff

> select /B:1

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select /B

5150 atoms, 5244 bonds, 647 residues, 1 model selected  

> color (#!1 & sel) #ff2f92ff

> color (#!1 & sel) #ff2600ff

> color (#!1 & sel) #ff2f92ff

> select add #1

10822 atoms, 11033 bonds, 9 pseudobonds, 1371 residues, 3 models selected  

> select subtract #1

2 models selected  

> color #1.1 #00f900ff models

> color #1.1 #ff7e79ff models

> color #1.1 black models

> color #1.1 white models

> set bgColor gray

> set bgColor #80808000

> set bgColor black

> set bgColor transparent

> color #1.1 #00fa92ff models

> color #1.1 #008f00ff models

> set bgColor white

> set bgColor #ffffff00

> lighting full

> lighting soft

> lighting simple

> lighting flat

> lighting shadows true intensity 0.5

> lighting shadows false

> lighting shadows true

> lighting shadows false

> lighting shadows true

> lighting shadows false

> graphics silhouettes false

> lighting simple

> graphics silhouettes true

> graphics silhouettes false

> lighting soft

> lighting full

> lighting shadows false

> lighting shadows true

> lighting shadows false

> lighting flat

> graphics silhouettes false

> graphics silhouettes true

> graphics silhouettes false

> graphics silhouettes true

> graphics silhouettes false

> graphics silhouettes true

> lighting simple

> graphics silhouettes false

> graphics silhouettes true

> lighting shadows true

> lighting shadows false

> set bgColor gray

> set bgColor #80808000

> set bgColor white

> set bgColor #ffffff00

> set bgColor black

> set bgColor transparent

> color #1.1 white models

> view orient

> set bgColor white

> set bgColor #ffffff00

> select /B

5150 atoms, 5244 bonds, 647 residues, 1 model selected  

> select
> /A:104-108,130-139,199-203,225-233,248-251,304-306,346-350,372-380,394-417,441-443,491-506,544-554,586-594,613-621,632-640,655-661,667-687,697-711

1416 atoms, 1415 bonds, 174 residues, 1 model selected  

> select /B:1

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select /B

5150 atoms, 5244 bonds, 647 residues, 1 model selected  

> color #1.1 #ff2600ff models

> hide #1.1 models

> show #1.1 models

> undo

[Repeated 3 time(s)]

> select add #1

10822 atoms, 11033 bonds, 9 pseudobonds, 1371 residues, 3 models selected  

> select subtract #1

2 models selected  

> select /B:1

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select /B

5150 atoms, 5244 bonds, 647 residues, 1 model selected  

> color #1.1 #ffd479ff models

> select add #1

10822 atoms, 11033 bonds, 9 pseudobonds, 1371 residues, 3 models selected  

> select subtract #1

2 models selected  

> select /B:1

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select /B

5150 atoms, 5244 bonds, 647 residues, 1 model selected  

> color (#!1 & sel) #ff2f92ff

> color (#!1 & sel) #0096ffff

> color (#!1 & sel) #5e5e5eff

> color (#!1 & sel) #919191ff

> color (#!1 & sel) #a9a9a9ff

> color (#!1 & sel) #424242ff

> color (#!1 & sel) #5e5e5eff

> color (#!1 & sel) #008f00ff

> select add #1

10822 atoms, 11033 bonds, 9 pseudobonds, 1371 residues, 3 models selected  

> select subtract #1

2 models selected  

> graphics silhouettes false

> graphics silhouettes true

> graphics silhouettes false

> lighting shadows true

> lighting shadows false

> lighting shadows true

> graphics silhouettes true

> view orient

> graphics silhouettes false

> color #1.1 #ff2f92ff models

> view orient

> view

> view orient

> view

> ui tool show "Side View"

> view orient

> select
> /A:61-69,77-81,94-99,116-120,143-151,157-164,172-176,189-194,211-215,238-245,312-317,325-329,336-341,357-362,385-392,431-435,459-464,470-475,485-489,523-530,537-540,598-604,607-612,646-650,690-692,715-719

1303 atoms, 1309 bonds, 157 residues, 1 model selected  

> select /B

5150 atoms, 5244 bonds, 647 residues, 1 model selected  

> hide sel cartoons

> select /A:1-477

3660 atoms, 3734 bonds, 477 residues, 1 model selected  

> select /A:381-382

13 atoms, 12 bonds, 2 residues, 1 model selected  

> select /A:145-382

1799 atoms, 1833 bonds, 238 residues, 1 model selected  

> select /A:2

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select /A:2-146

1097 atoms, 1117 bonds, 145 residues, 1 model selected  

> select /A:1-477

3660 atoms, 3734 bonds, 477 residues, 1 model selected  

> select clear

> select sequence
> YEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRR

673 atoms, 682 bonds, 89 residues, 1 model selected  

> volume style surface

No volumes specified  

> volume style image

No volumes specified  

> volume style mesh

No volumes specified  

> volume style surface

No volumes specified  

> surface :A[63-151]

Expected an atoms specifier or a keyword  

> split

Split fold_par3c_e_and_full_length_psd95_model_0.cif (#1) into 2 models  
Chain information for fold_par3c_e_and_full_length_psd95_model_0.cif A #1.1  
---  
Chain | Description  
A | No description available  
  
Chain information for fold_par3c_e_and_full_length_psd95_model_0.cif B #1.2  
---  
Chain | Description  
B | No description available  
  

> hide #1.1 models

> show #1.1 models

> hide #1.2 models

> show #1.2 models

> show atoms

> hide #1.2 models

> show #1.2 models

> hide #1.2 models

> show #1.2 models

> hide #1.1 models

> show #1.1 models

> hide #1.1 models

> show #1.1 models

> hide #1.2 models

> help help:user/menu.html#named-selections

> ui tool show "Show Sequence Viewer"

> sequence chain #1.1/A

Alignment identifier is 1.1/A  

> sequence chain #1.2/B

Alignment identifier is 1.2/B  

> select
> #1.1/A:104-108,130-139,199-203,225-233,248-251,304-306,346-350,372-380,394-417,441-443,491-506,544-554,586-594,613-621,632-640,655-661,667-687,697-711

1416 atoms, 1415 bonds, 174 residues, 1 model selected  

> select #1.1/A:1

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1.1/A:1-66

519 atoms, 531 bonds, 66 residues, 1 model selected  

> select #1.1/A:47

5 atoms, 4 bonds, 1 residue, 1 model selected  

> select #1.1/A:45-47

22 atoms, 21 bonds, 3 residues, 1 model selected  

> select #1.1/A:46-47

14 atoms, 13 bonds, 2 residues, 1 model selected  

> select #1.1/A:46-47

14 atoms, 13 bonds, 2 residues, 1 model selected  

> select #1.1/A:50

12 atoms, 12 bonds, 1 residue, 1 model selected  

> select #1.1/A:48-50

23 atoms, 24 bonds, 3 residues, 1 model selected  

> select #1.1/A:52

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1.1/A:51-52

17 atoms, 16 bonds, 2 residues, 1 model selected  

> select #1.1/A:55

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1.1/A:53-55

24 atoms, 23 bonds, 3 residues, 1 model selected  

> select #1.1/A:60

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1.1/A:57-60

29 atoms, 28 bonds, 4 residues, 1 model selected  

> select #1.1/A:56

4 atoms, 3 bonds, 1 residue, 1 model selected  

> select #1.1/A:55-56

12 atoms, 11 bonds, 2 residues, 1 model selected  

> select #1.1/A:56-57

11 atoms, 10 bonds, 2 residues, 1 model selected  

> select #1.1/A:1-57

442 atoms, 453 bonds, 57 residues, 1 model selected  

> select #1.1/A:59

4 atoms, 3 bonds, 1 residue, 1 model selected  

> select #1.1/A:1-59

455 atoms, 466 bonds, 59 residues, 1 model selected  

> hide sel surfaces

[Repeated 1 time(s)]

> show sel atoms

> show sel cartoons

[Repeated 3 time(s)]

> hide sel surfaces

> style sel stick

Changed 455 atom styles  

> hide sel atoms

> show sel cartoons

> select #1.1/A:369-370

13 atoms, 12 bonds, 2 residues, 1 model selected  

> select #1.1/A:314-370

410 atoms, 414 bonds, 57 residues, 1 model selected  

> select #1.1/A:268

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1.1/A:160-268

814 atoms, 829 bonds, 109 residues, 1 model selected  

> select #1.1/A:160

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1.1/A:156-160

42 atoms, 41 bonds, 5 residues, 1 model selected  

> select #1.1/A:320-321

13 atoms, 12 bonds, 2 residues, 1 model selected  

> select #1.1/A:317-321

38 atoms, 38 bonds, 5 residues, 1 model selected  

> select #1.1/A:315

7 atoms, 6 bonds, 1 residue, 1 model selected  

> select #1.1/A:312-315

37 atoms, 36 bonds, 4 residues, 1 model selected  

> select #1.1/A:272

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1.1/A:269-272

33 atoms, 32 bonds, 4 residues, 1 model selected  

> select #1.1/A:283-284

14 atoms, 14 bonds, 2 residues, 1 model selected  

> select #1.1/A:268-284

134 atoms, 137 bonds, 17 residues, 1 model selected  

> select #1.1/A:318

11 atoms, 10 bonds, 1 residue, 1 model selected  

> select #1.1/A:260-318

476 atoms, 488 bonds, 59 residues, 1 model selected  

> select #1.1/A:260

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1.1/A:255-260

47 atoms, 49 bonds, 6 residues, 1 model selected  

> select #1.1/A:264

12 atoms, 12 bonds, 1 residue, 1 model selected  

> select #1.1/A:260-264

40 atoms, 40 bonds, 5 residues, 1 model selected  

> select #1.1/A:264

12 atoms, 12 bonds, 1 residue, 1 model selected  

> select #1.1/A:264-267

37 atoms, 38 bonds, 4 residues, 1 model selected  

> select #1.1/A:267

10 atoms, 10 bonds, 1 residue, 1 model selected  

> select #1.1/A:267-302

283 atoms, 291 bonds, 36 residues, 1 model selected  

> select #1.1/A:267

10 atoms, 10 bonds, 1 residue, 1 model selected  

> select #1.1/A:267-291

191 atoms, 197 bonds, 25 residues, 1 model selected  

> select #1.1/A:152

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1.1/A:152-155

28 atoms, 29 bonds, 4 residues, 1 model selected  

> select #1.1/A:152

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1.1/A:152-159

61 atoms, 62 bonds, 8 residues, 1 model selected  

> hide sel atoms

> show sel cartoons

> select #1.1/A:206

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1.1/A:205-206

19 atoms, 18 bonds, 2 residues, 1 model selected  

> select #1.1/A:245

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1.1/A:245-246

16 atoms, 16 bonds, 2 residues, 1 model selected  

> select #1.1/A:244-245

14 atoms, 13 bonds, 2 residues, 1 model selected  

> select #1.1/A:245-309

508 atoms, 523 bonds, 65 residues, 1 model selected  

> hide sel atoms

> hide sel cartoons

> show sel cartoons

> select
> #1.1/A:104-108,130-139,199-203,225-233,248-251,304-306,346-350,372-380,394-417,441-443,491-506,544-554,586-594,613-621,632-640,655-661,667-687,697-711

1416 atoms, 1415 bonds, 174 residues, 1 model selected  

> select #1.1/A:401

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1.1/A:401-402

14 atoms, 13 bonds, 2 residues, 1 model selected  

> select #1.1/A:401

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1.1/A:401-425

187 atoms, 187 bonds, 25 residues, 1 model selected  

> select #1.1/A:401

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1.1/A:401-429

222 atoms, 223 bonds, 29 residues, 1 model selected  

> hide sel atoms

> select
> #1.1/A:104-108,130-139,199-203,225-233,248-251,304-306,346-350,372-380,394-417,441-443,491-506,544-554,586-594,613-621,632-640,655-661,667-687,697-711

1416 atoms, 1415 bonds, 174 residues, 1 model selected  

> select #1.1/A:496

11 atoms, 10 bonds, 1 residue, 1 model selected  

> select #1.1/A:496

11 atoms, 10 bonds, 1 residue, 1 model selected  

> select #1.1/A:496

11 atoms, 10 bonds, 1 residue, 1 model selected  

> select #1.1/A:496-532

300 atoms, 305 bonds, 37 residues, 1 model selected  

> hide sel atoms

> select #1.1/A:712

6 atoms, 5 bonds, 1 residue, 1 model selected  

> select #1.1/A:712-724

110 atoms, 114 bonds, 13 residues, 1 model selected  

> hide sel atoms

> select sequence
> GFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVE

546 atoms, 560 bonds, 66 residues, 1 model selected  

> select clear

> select sequence
> YARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDL

1459 atoms, 1488 bonds, 179 residues, 1 model selected  

> show #1.2 models

> hide #1.2 models

> show #1.2 models

> hide #1.1 models

> select
> #1.2/B:28-34,38-46,53-63,70-73,92-95,174-176,180-193,208-223,341-383,385-387,441-456,568-591,627-637

1366 atoms, 1368 bonds, 165 residues, 1 model selected  

> select #1.2/B:149

5 atoms, 4 bonds, 1 residue, 1 model selected  

> select #1.2/B:149

5 atoms, 4 bonds, 1 residue, 1 model selected  

> select #1.2/B:1

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1.2/B:1-23

170 atoms, 173 bonds, 23 residues, 1 model selected  

> select #1.2/B:35

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1.2/B:35-44

87 atoms, 88 bonds, 10 residues, 1 model selected  

> select #1.2/B:51

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1.2/B:51-63

98 atoms, 98 bonds, 13 residues, 1 model selected  

> select #1.2/B:65-66

21 atoms, 21 bonds, 2 residues, 1 model selected  

> select #1.2/B:65-73

73 atoms, 74 bonds, 9 residues, 1 model selected  

> select #1.2/B:74

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1.2/B:74-84

87 atoms, 87 bonds, 11 residues, 1 model selected  

> select #1.2/B:85

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1.2/B:85-93

73 atoms, 76 bonds, 9 residues, 1 model selected  

> select #1.2/B:85

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1.2/B:85-86

19 atoms, 18 bonds, 2 residues, 1 model selected  

> select #1.2/B:85

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1.2/B:85-195

810 atoms, 823 bonds, 111 residues, 1 model selected  

> select #1.2/B:195-196

12 atoms, 11 bonds, 2 residues, 1 model selected  

> select #1.2/B:193-196

28 atoms, 27 bonds, 4 residues, 1 model selected  

> select #1.2/B:171

7 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1.2/B:134-171

289 atoms, 293 bonds, 38 residues, 1 model selected  

> hide sel atoms

> show sel cartoons

> select #1.2/B:133-134

15 atoms, 14 bonds, 2 residues, 1 model selected  

> select #1.2/B:112-134

159 atoms, 161 bonds, 23 residues, 1 model selected  

> show sel cartoons

> hide sel atoms

> select
> #1.2/B:28-34,38-46,53-63,70-73,92-95,174-176,180-193,208-223,341-383,385-387,441-456,568-591,627-637

1366 atoms, 1368 bonds, 165 residues, 1 model selected  

> select

10822 atoms, 11033 bonds, 1371 residues, 3 models selected  

> hide sel & #1.2 atoms

> show sel & #1.2 cartoons

> select #1.2/B:57

5 atoms, 4 bonds, 1 residue, 1 model selected  

> select #1.2/B:57-172

862 atoms, 878 bonds, 116 residues, 1 model selected  

> select
> #1.2/B:28-34,38-46,53-63,70-73,92-95,174-176,180-193,208-223,341-383,385-387,441-456,568-591,627-637

1366 atoms, 1368 bonds, 165 residues, 1 model selected  

> hide #!1 models

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/fold_par3c_e_and_full_length_psd95_s799_phosphorylated/fold_par3c_e_and_full_length_psd95_s799_phosphorylated_model_0.cif

Chain information for
fold_par3c_e_and_full_length_psd95_s799_phosphorylated_model_0.cif #2  
---  
Chain | Description  
A | .  
B | .  
  
Computing secondary structure  

> color #2 bychain

> show #!1 models

> hide #!1 models

> view orient

> hide #2 models

> show #!1 models

> view orient

> show #2 models

> hide #2 models

> show #2 models

> show #1.1 models

> hide #1.1 models

> show #1.1 models

> hide #1.1 models

> show #1.1 models

> hide #1.1 models

> split

Did not split fold_par3c_e_and_full_length_psd95_model_0.cif A, has only one
piece  
Did not split fold_par3c_e_and_full_length_psd95_model_0.cif B, has only one
piece  
Split fold_par3c_e_and_full_length_psd95_s799_phosphorylated_model_0.cif (#2)
into 2 models  
Chain information for
fold_par3c_e_and_full_length_psd95_s799_phosphorylated_model_0.cif A #2.1  
---  
Chain | Description  
A | No description available  
  
Chain information for
fold_par3c_e_and_full_length_psd95_s799_phosphorylated_model_0.cif B #2.2  
---  
Chain | Description  
B | No description available  
  

> hide #2.1 models

> hide #2.2 models

> show #2.2 models

> hide #2.2 models

> show #2.2 models

> hide #2.2 models

> show #2.2 models

> ui tool show Matchmaker

> matchmaker #2.2 to #1.2

Parameters  
---  
Chain pairing | bb  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker fold_par3c_e_and_full_length_psd95_model_0.cif B, chain B (#1.2)
with fold_par3c_e_and_full_length_psd95_s799_phosphorylated_model_0.cif B,
chain B (#2.2), sequence alignment score = 3002.1  
RMSD between 33 pruned atom pairs is 0.963 angstroms; (across all 647 pairs:
74.449)  
  

> select add #1.2

5150 atoms, 5244 bonds, 647 residues, 1 model selected  

> select subtract #1.2

Nothing selected  

> hide #1.2 models

> show #1.2 models

> hide #1.2 models

> show #1.2 models

> hide #1.2 models

> show #1.2 models

> hide #2.2 models

> show #2.2 models

> hide #1.2 models

> hide #2.2 models

> show #1.2 models

> show #2.2 models

> hide #2.2 models

> show #2.2 models

> hide #2.2 models

> show #2.2 models

> hide #2.2 models

> show #2.2 models

> hide #2.2 models

> show #2.2 models

> hide #2.2 models

> show #2.2 models

> show #1.2#2.2 surfaces

> hide #!2.2 models

> select add #1.2

5150 atoms, 5244 bonds, 647 residues, 1 model selected  

> hide sel atoms

> hide sel cartoons

> hide sel surfaces

> show sel cartoons

> select subtract #1.2

1 model selected  

> show #1.1 models

> select add #1.1

5672 atoms, 5789 bonds, 724 residues, 1 model selected  

> show sel surfaces

> hide sel surfaces

> select subtract #1.1

1 model selected  

> color #1.2 #ff40ffff

> select #1.2/B:57

5 atoms, 4 bonds, 1 residue, 1 model selected  

> select #1.2/B:57-73

128 atoms, 129 bonds, 17 residues, 1 model selected  

> select add #1.2

5150 atoms, 5244 bonds, 647 residues, 2 models selected  

> select subtract #1.2

1 model selected  

> hide #!1 models

> show #2.1 models

> show #!2.2 models

> hide #!2.2 models

> select sequence
> YEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRR

1346 atoms, 1364 bonds, 178 residues, 2 models selected  

> show sel & #2.1 surfaces

> select sequence
> EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVA

1254 atoms, 1270 bonds, 170 residues, 2 models selected  

> show sel & #!2.1 surfaces

> select sequence
> EPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRF

1370 atoms, 1390 bonds, 182 residues, 2 models selected  

> show sel & #!2.1 surfaces

> select sequence
> GFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVE

1092 atoms, 1120 bonds, 132 residues, 2 models selected  

> show sel & #!2.1 surfaces

> select sequence
> YARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDL

2918 atoms, 2976 bonds, 358 residues, 2 models selected  

> show sel & #!2.1 surfaces

> show #!2.2 models

> hide #!2.1 models

> hide #!2.2 surfaces

> show #!2.1 models

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/fold_par3c_e_and_full_length_psd95_s799_phosphorylated/fold_par3c_e_and_full_length_psd95_s799_phosphorylated_full_data_0.json

Traceback (most recent call last):  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/ui/graphics.py", line 54, in event  
if self.handle_drag_and_drop(event):  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/ui/graphics.py", line 124, in handle_drag_and_drop  
mw.dropEvent(event)  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/ui/gui.py", line 768, in dropEvent  
_open_dropped_file(self.session, p)  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/ui/gui.py", line 2154, in _open_dropped_file  
run(session, 'open %s' % FileNameArg.unparse(path))  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/core/commands/run.py", line 49, in run  
results = command.run(text, log=log, return_json=return_json)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/core/commands/cli.py", line 3221, in run  
result = ci.function(session, **kw_args)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/open_command/cmd.py", line 132, in cmd_open  
models = Command(session, registry=registry).run(provider_cmd_text,
log=log)[0]  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/core/commands/cli.py", line 3221, in run  
result = ci.function(session, **kw_args)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/open_command/cmd.py", line 215, in provider_open  
models, status = collated_open(session, None, [data], data_format,
_add_models,  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/open_command/cmd.py", line 526, in collated_open  
return remember_data_format()  
^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/open_command/cmd.py", line 497, in remember_data_format  
models, status = func(*func_args, **func_kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/alphafold/__init__.py", line 129, in open  
pae = alphafold_pae(session, file = path, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/alphafold/pae.py", line 1457, in alphafold_pae  
structure = _guess_pae_associated_structure(session, file)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/alphafold/pae.py", line 1516, in
_guess_pae_associated_structure  
structs = [m for m in session.models.list(type = AtomicStructure)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/alphafold/pae.py", line 1517, in <listcomp>  
if hasattr(m, 'filename') and dirname(m.filename) == dirname(pae_path)]  
^^^^^^^^^^^^^^^^^^^  
File "<frozen posixpath>", line 152, in dirname  
TypeError: expected str, bytes or os.PathLike object, not NoneType  
  
TypeError: expected str, bytes or os.PathLike object, not NoneType  
  
File "", line 152, in dirname  
  
See log for complete Python traceback.  
  

> open /Users/hannacaiola/Library/CloudStorage/Box-
> Box/Zhang_Lab/Hanna/_Par3/Alphafold/fold_par3c_e_and_full_length_psd95_s799_phosphorylated/fold_par3c_e_and_full_length_psd95_s799_phosphorylated_full_data_0.json

Traceback (most recent call last):  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/ui/graphics.py", line 54, in event  
if self.handle_drag_and_drop(event):  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/ui/graphics.py", line 124, in handle_drag_and_drop  
mw.dropEvent(event)  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/ui/gui.py", line 768, in dropEvent  
_open_dropped_file(self.session, p)  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/ui/gui.py", line 2154, in _open_dropped_file  
run(session, 'open %s' % FileNameArg.unparse(path))  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/core/commands/run.py", line 49, in run  
results = command.run(text, log=log, return_json=return_json)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/core/commands/cli.py", line 3221, in run  
result = ci.function(session, **kw_args)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/open_command/cmd.py", line 132, in cmd_open  
models = Command(session, registry=registry).run(provider_cmd_text,
log=log)[0]  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/core/commands/cli.py", line 3221, in run  
result = ci.function(session, **kw_args)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/open_command/cmd.py", line 215, in provider_open  
models, status = collated_open(session, None, [data], data_format,
_add_models,  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/open_command/cmd.py", line 526, in collated_open  
return remember_data_format()  
^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/open_command/cmd.py", line 497, in remember_data_format  
models, status = func(*func_args, **func_kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/alphafold/__init__.py", line 129, in open  
pae = alphafold_pae(session, file = path, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/alphafold/pae.py", line 1457, in alphafold_pae  
structure = _guess_pae_associated_structure(session, file)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/alphafold/pae.py", line 1516, in
_guess_pae_associated_structure  
structs = [m for m in session.models.list(type = AtomicStructure)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File
"/Applications/ChimeraX-1.10.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/alphafold/pae.py", line 1517, in <listcomp>  
if hasattr(m, 'filename') and dirname(m.filename) == dirname(pae_path)]  
^^^^^^^^^^^^^^^^^^^  
File "<frozen posixpath>", line 152, in dirname  
TypeError: expected str, bytes or os.PathLike object, not NoneType  
  
TypeError: expected str, bytes or os.PathLike object, not NoneType  
  
File "", line 152, in dirname  
  
See log for complete Python traceback.  
  




OpenGL version: 4.1 Metal - 89.4
OpenGL renderer: Apple M1
OpenGL vendor: Apple

Python: 3.11.4
Locale: en_US.UTF-8
Qt version: PyQt6 6.8.1, Qt 6.8.2
Qt runtime version: 6.8.2
Qt platform: cocoa
Hardware:

    Hardware Overview:

      Model Name: MacBook Air
      Model Identifier: MacBookAir10,1
      Model Number: MGN73LL/A
      Chip: Apple M1
      Total Number of Cores: 8 (4 performance and 4 efficiency)
      Memory: 8 GB
      System Firmware Version: 11881.140.96
      OS Loader Version: 11881.140.96

Software:

    System Software Overview:

      System Version: macOS 15.6.1 (24G90)
      Kernel Version: Darwin 24.6.0
      Time since boot: 24 days, 8 hours, 34 minutes

Graphics/Displays:

    Apple M1:

      Chipset Model: Apple M1
      Type: GPU
      Bus: Built-In
      Total Number of Cores: 8
      Vendor: Apple (0x106b)
      Metal Support: Metal 3
      Displays:
        Color LCD:
          Display Type: Built-In Retina LCD
          Resolution: 2560 x 1600 Retina
          Main Display: Yes
          Mirror: Off
          Online: Yes
          Automatically Adjust Brightness: No
          Connection Type: Internal


Installed Packages:
    alabaster: 1.0.0
    appdirs: 1.4.4
    appnope: 0.1.4
    asttokens: 3.0.0
    babel: 2.17.0
    beautifulsoup4: 4.13.3
    blockdiag: 3.0.0
    blosc2: 3.6.1
    build: 1.2.2.post1
    certifi: 2023.11.17
    cftime: 1.6.4.post1
    charset-normalizer: 3.4.2
    ChimeraX-AddCharge: 1.5.19
    ChimeraX-AddH: 2.2.7
    ChimeraX-AlignmentAlgorithms: 2.0.2
    ChimeraX-AlignmentHdrs: 3.6.1
    ChimeraX-AlignmentMatrices: 2.1
    ChimeraX-Alignments: 2.20.2
    ChimeraX-AlphaFold: 1.0.1
    ChimeraX-AltlocExplorer: 1.1.2
    ChimeraX-AmberInfo: 1.0
    ChimeraX-Aniso: 1.1.4
    ChimeraX-Arrays: 1.1
    ChimeraX-Atomic: 1.60.7
    ChimeraX-AtomicLibrary: 14.1.19
    ChimeraX-AtomSearch: 2.0.1
    ChimeraX-AxesPlanes: 2.4
    ChimeraX-BasicActions: 1.1.3
    ChimeraX-BILD: 1.0
    ChimeraX-BlastProtein: 3.0.0
    ChimeraX-Boltz: 1.0
    ChimeraX-BondRot: 2.0.4
    ChimeraX-BugReporter: 1.0.2
    ChimeraX-BuildStructure: 2.13.1
    ChimeraX-Bumps: 1.0
    ChimeraX-BundleBuilder: 1.5.1
    ChimeraX-ButtonPanel: 1.0.1
    ChimeraX-CageBuilder: 1.0.1
    ChimeraX-CellPack: 1.0
    ChimeraX-Centroids: 1.4
    ChimeraX-ChangeChains: 1.1
    ChimeraX-CheckWaters: 1.5
    ChimeraX-ChemGroup: 2.0.2
    ChimeraX-Clashes: 2.3
    ChimeraX-ColorActions: 1.0.5
    ChimeraX-ColorGlobe: 1.0
    ChimeraX-ColorKey: 1.5.8
    ChimeraX-CommandLine: 1.3
    ChimeraX-ConnectStructure: 2.0.1
    ChimeraX-Contacts: 1.0.1
    ChimeraX-Core: 1.10.1
    ChimeraX-CoreFormats: 1.2
    ChimeraX-coulombic: 1.4.5
    ChimeraX-Crosslinks: 1.0
    ChimeraX-Crystal: 1.0
    ChimeraX-CrystalContacts: 1.0.1
    ChimeraX-DataFormats: 1.2.4
    ChimeraX-Dicom: 1.2.7
    ChimeraX-DistMonitor: 1.4.2
    ChimeraX-DockPrep: 1.1.4
    ChimeraX-Dssp: 2.0
    ChimeraX-EMDB-SFF: 1.0
    ChimeraX-ESMFold: 1.0
    ChimeraX-FileHistory: 1.0.1
    ChimeraX-FunctionKey: 1.0.1
    ChimeraX-Geometry: 1.3
    ChimeraX-gltf: 1.0
    ChimeraX-Graphics: 1.4.1
    ChimeraX-Hbonds: 2.5.1
    ChimeraX-Help: 1.3
    ChimeraX-HKCage: 1.3
    ChimeraX-IHM: 1.1
    ChimeraX-ImageFormats: 1.2
    ChimeraX-IMOD: 1.0
    ChimeraX-IO: 1.0.3
    ChimeraX-ItemsInspection: 1.0.1
    ChimeraX-IUPAC: 1.0
    ChimeraX-KVFinder: 1.6.2
    ChimeraX-Label: 1.1.14
    ChimeraX-ListInfo: 1.2.2
    ChimeraX-Log: 1.2
    ChimeraX-LookingGlass: 1.1
    ChimeraX-Maestro: 1.9.1
    ChimeraX-Map: 1.3
    ChimeraX-MapData: 2.0
    ChimeraX-MapEraser: 1.0.1
    ChimeraX-MapFilter: 2.0.1
    ChimeraX-MapFit: 2.0
    ChimeraX-MapSeries: 2.1.1
    ChimeraX-Markers: 1.0.1
    ChimeraX-Mask: 1.0.2
    ChimeraX-MatchMaker: 2.2.2
    ChimeraX-MCopy: 1.0
    ChimeraX-MDcrds: 2.10.1
    ChimeraX-MedicalToolbar: 1.1
    ChimeraX-Meeting: 1.0.1
    ChimeraX-MLP: 1.1.1
    ChimeraX-mmCIF: 2.16
    ChimeraX-MMTF: 2.2
    ChimeraX-ModelArchive: 1.0
    ChimeraX-Modeller: 1.5.19
    ChimeraX-ModelPanel: 1.5.1
    ChimeraX-ModelSeries: 1.0.1
    ChimeraX-Mol2: 2.0.3
    ChimeraX-Mole: 1.0
    ChimeraX-Morph: 1.0.2
    ChimeraX-MouseModes: 1.2
    ChimeraX-Movie: 1.0
    ChimeraX-MutationScores: 1.0
    ChimeraX-Neuron: 1.0
    ChimeraX-Nifti: 1.2
    ChimeraX-NMRSTAR: 1.0.2
    ChimeraX-NRRD: 1.2
    ChimeraX-Nucleotides: 2.0.3
    ChimeraX-OpenCommand: 1.14.1
    ChimeraX-OrthoPick: 1.0.1
    ChimeraX-PDB: 2.7.10
    ChimeraX-PDBBio: 1.0.1
    ChimeraX-PDBLibrary: 1.0.4
    ChimeraX-PDBMatrices: 1.0
    ChimeraX-PickBlobs: 1.0.1
    ChimeraX-Positions: 1.0
    ChimeraX-PresetMgr: 1.1.3
    ChimeraX-ProfileGrids: 1.1.3
    ChimeraX-PubChem: 2.2
    ChimeraX-ReadPbonds: 1.0.1
    ChimeraX-Registration: 1.1.2
    ChimeraX-RemoteControl: 1.0
    ChimeraX-RenderByAttr: 1.6.3
    ChimeraX-RenumberResidues: 1.1
    ChimeraX-ResidueFit: 1.0.1
    ChimeraX-RestServer: 1.3.1
    ChimeraX-RNALayout: 1.0
    ChimeraX-RotamerLibMgr: 4.0
    ChimeraX-RotamerLibsDunbrack: 2.0
    ChimeraX-RotamerLibsDynameomics: 2.0
    ChimeraX-RotamerLibsRichardson: 2.0
    ChimeraX-SaveCommand: 1.5.1
    ChimeraX-SchemeMgr: 1.0
    ChimeraX-SDF: 2.0.3
    ChimeraX-Segger: 1.0
    ChimeraX-Segment: 1.0.1
    ChimeraX-Segmentations: 3.5.7
    ChimeraX-SelInspector: 1.0
    ChimeraX-SeqView: 2.17.1
    ChimeraX-Shape: 1.1
    ChimeraX-Shell: 1.0.1
    ChimeraX-Shortcuts: 1.2.1
    ChimeraX-ShowSequences: 1.0.3
    ChimeraX-SideView: 1.0.1
    ChimeraX-SimilarStructures: 1.0.1
    ChimeraX-Smiles: 2.1.2
    ChimeraX-SmoothLines: 1.0
    ChimeraX-SpaceNavigator: 1.0
    ChimeraX-StdCommands: 1.19.1
    ChimeraX-STL: 1.0.1
    ChimeraX-Storm: 1.0
    ChimeraX-StructMeasure: 1.2.1
    ChimeraX-Struts: 1.0.1
    ChimeraX-Surface: 1.0.1
    ChimeraX-SwapAA: 2.0.1
    ChimeraX-SwapRes: 2.5.2
    ChimeraX-TapeMeasure: 1.0
    ChimeraX-TaskManager: 1.0
    ChimeraX-Test: 1.0
    ChimeraX-Toolbar: 1.2.3
    ChimeraX-ToolshedUtils: 1.2.4
    ChimeraX-Topography: 1.0
    ChimeraX-ToQuest: 1.0
    ChimeraX-Tug: 1.0.1
    ChimeraX-UI: 1.45.2
    ChimeraX-Umap: 1.0
    ChimeraX-uniprot: 2.3.1
    ChimeraX-UnitCell: 1.0.1
    ChimeraX-ViewDockX: 1.4.4
    ChimeraX-VIPERdb: 1.0
    ChimeraX-Vive: 1.1
    ChimeraX-VolumeMenu: 1.0.1
    ChimeraX-vrml: 1.0
    ChimeraX-VTK: 1.0
    ChimeraX-WavefrontOBJ: 1.0
    ChimeraX-WebCam: 1.0.2
    ChimeraX-WebServices: 1.1.5
    ChimeraX-Zone: 1.0.1
    colorama: 0.4.6
    comm: 0.2.2
    contourpy: 1.3.2
    coverage: 7.10.0
    cxservices: 1.2.3
    cycler: 0.12.1
    Cython: 3.0.12
    debugpy: 1.8.15
    decorator: 5.2.1
    docutils: 0.21.2
    executing: 2.2.0
    filelock: 3.18.0
    fonttools: 4.59.0
    funcparserlib: 2.0.0a0
    glfw: 2.9.0
    grako: 3.16.5
    h5py: 3.14.0
    html2text: 2024.2.26
    idna: 3.10
    ihm: 2.2
    imagecodecs: 2024.6.1
    imagesize: 1.4.1
    iniconfig: 2.1.0
    ipykernel: 6.29.5
    ipython: 8.26.0
    ipywidgets: 8.1.7
    jedi: 0.19.1
    Jinja2: 3.1.6
    jupyter_client: 8.6.3
    jupyter_core: 5.8.1
    jupyterlab_widgets: 3.0.15
    kiwisolver: 1.4.8
    line_profiler: 4.2.0
    lxml: 5.3.1
    lz4: 4.3.2
    MarkupSafe: 3.0.2
    matplotlib: 3.10.1
    matplotlib-inline: 0.1.7
    msgpack: 1.1.0
    narwhals: 2.5.0
    ndindex: 1.10.0
    nest-asyncio: 1.6.0
    netCDF4: 1.6.5
    networkx: 3.3
    nibabel: 5.2.0
    nptyping: 2.5.0
    numexpr: 2.11.0
    numpy: 2.3.3
    numpy: 1.26.4
    OpenMM: 8.2.0
    openvr: 1.26.701
    packaging: 24.2
    ParmEd: 4.2.2
    parso: 0.8.4
    pep517: 0.13.1
    pexpect: 4.9.0
    pickleshare: 0.7.5
    pillow: 10.4.0
    pip: 25.0.1
    pkginfo: 1.11.1
    platformdirs: 4.3.8
    plotly: 6.3.0
    pluggy: 1.6.0
    prompt_toolkit: 3.0.51
    psutil: 7.0.0
    ptyprocess: 0.7.0
    pure_eval: 0.2.3
    py-cpuinfo: 9.0.0
    pycollada: 0.8
    pydicom: 2.4.4
    Pygments: 2.18.0
    pyKVFinder: 0.8.2
    pynmrstar: 3.3.5
    pynrrd: 1.0.0
    PyOpenGL: 3.1.9
    PyOpenGL-accelerate: 3.1.9
    pyopenxr: 1.1.4501
    pyparsing: 3.2.3
    pyproject_hooks: 1.2.0
    PyQt6-commercial: 6.8.1
    PyQt6-Qt6: 6.8.2
    PyQt6-WebEngine-commercial: 6.8.0
    PyQt6-WebEngine-Qt6: 6.8.2
    PyQt6_sip: 13.10.0
    pytest: 8.4.1
    pytest-cov: 6.2.1
    python-dateutil: 2.9.0.post0
    pytz: 2025.2
    pyzmq: 27.0.0
    qtconsole: 5.5.2
    QtPy: 2.4.3
    qtshim: 1.1
    RandomWords: 0.4.0
    requests: 2.32.3
    roman-numerals-py: 3.1.0
    scipy: 1.14.0
    setuptools: 78.1.0
    sfftk-rw: 0.8.1
    six: 1.16.0
    snowballstemmer: 3.0.1
    sortedcontainers: 2.4.0
    soupsieve: 2.7
    Sphinx: 8.2.3
    sphinx-autodoc-typehints: 3.1.0
    sphinxcontrib-applehelp: 2.0.0
    sphinxcontrib-blockdiag: 3.0.0
    sphinxcontrib-devhelp: 2.0.0
    sphinxcontrib-htmlhelp: 2.1.0
    sphinxcontrib-jsmath: 1.0.1
    sphinxcontrib-qthelp: 2.0.0
    sphinxcontrib-serializinghtml: 2.0.0
    stack-data: 0.6.3
    superqt: 0.7.1
    tables: 3.10.2
    tcia_utils: 1.5.1
    tifffile: 2025.3.13
    tinyarray: 1.2.4
    tomlkit: 0.13.3
    tornado: 6.5.1
    traitlets: 5.14.3
    typing_extensions: 4.14.1
    tzdata: 2025.2
    urllib3: 2.5.0
    wcwidth: 0.2.13
    webcolors: 24.11.1
    wheel: 0.45.1
    wheel-filename: 1.4.2
    widgetsnbextension: 4.0.14

Change History (2)

comment:1 by Eric Pettersen, 6 months ago

Component: UnassignedStructure Prediction
Owner: set to Tom Goddard
Platform: all
Project: ChimeraX
Status: newassigned
Summary: ChimeraX bug report submissionAlphaFold JSON drag and drop: pae_path is None

comment:2 by Tom Goddard, 6 months ago

Resolution: fixed
Status: assignedclosed

Fixed.

User opened AlphaFold 3 structure then split it by chain then tried to open the PAE .json file for the structure. The code assumed mol.filename was not None, but split made the filename None. Added check for mol.filename = None.

Note: See TracTickets for help on using tickets.