#18680 closed defect (can't reproduce)

Crash in event loop

Reported by: chimerax-bug-report@… Owned by: Eric Pettersen
Priority: normal Milestone:
Component: Core Version:
Keywords: Cc: Tom Goddard
Blocked By: Blocking:
Notify when closed: Platform: all
Project: ChimeraX

Description

The following bug report has been submitted:
Platform:        Windows-10-10.0.19045
ChimeraX Version: 1.11.dev202508300055 (2025-08-30 00:55:12 UTC)
Description
Last time you used ChimeraX it crashed.
Please describe steps that led to the crash here.
Windows fatal exception: access violation

Current thread 0x000002e8 (most recent call first):
  File "C:\Program Files\ChimeraX 1.11.dev202508300055\bin\Lib\site-packages\chimerax\ui\gui.py", line 368 in event_loop
  File "C:\Program Files\ChimeraX 1.11.dev202508300055\bin\Lib\site-packages\chimerax\core\__main__.py", line 1064 in init
  File "C:\Program Files\ChimeraX 1.11.dev202508300055\bin\Lib\site-packages\chimerax\core\__main__.py", line 1229 in 
  File "", line 88 in _run_code
  File "", line 198 in _run_module_as_main
===== Log before crash start =====
UCSF ChimeraX version: 1.11.dev202508300055 (2025-08-30)  
© 2016-2025 Regents of the University of California. All rights reserved.  
How to cite UCSF ChimeraX  

> open "I:\Chimera\AF Presentation\TRPV4 AF3\TRPV4 pdb data\6F55-assembly1
> SdpIIISH3 TRPV4PRD.cif\6f55-assembly1.cif" format mmcif

6f55-assembly1.cif title:  
Complex structure of PACSIN SH3 domain and TRPV4 proline rich region [more
info...]  
  
Chain information for 6f55-assembly1.cif #1  
---  
Chain | Description  
A | PACSIN 3  
B | PRR  
  

> ui autostart false "AlphaFold Error Plot"

> ui tool show AlphaFold

> ui autostart true "AlphaFold Error Plot"

> alphafold match #1

Cannot search short sequences less than 20 amino acids  

Fetching compressed AlphaFold Q1G1I6 from
https://alphafold.ebi.ac.uk/files/AF-Q1G1I6-F1-model_v4.cif  
1 AlphaFold model found using sequence similarity searches: Q1G1I6 (chain A)  

No AlphaFold model with similar sequence for chain B  

AlphaFold prediction matching 6f55-assembly1.cif  
---  
Chain| UniProt Id| UniProt Name| RMSD| Length| Seen| % Id  
A | Q1G1I6 | Q1G1I6_CHICK | 1.44 | 64 | 67 | 98   
  
Opened 1 AlphaFold model  

> alphafold match #1/B

Cannot search short sequences less than 20 amino acids  

No AlphaFold model with similar sequence for chain B  

Opened 0 AlphaFold model  

> hide #2.1 models

> show #2.1 models

> hide #2.1 models

> show #2.1 models

> alphafold match #1/A

1 AlphaFold model found using sequence similarity searches: Q1G1I6 (chain A)  
AlphaFold prediction matching 6f55-assembly1.cif  
---  
Chain| UniProt Id| UniProt Name| RMSD| Length| Seen| % Id  
A | Q1G1I6 | Q1G1I6_CHICK | 1.44 | 64 | 67 | 98   
  
Opened 1 AlphaFold model  

> hide #2.1 models

> show #2.1 models

> hide #3.1 models

> hide #!3 models

> show #!3 models

> show #3.1 models

> hide #3.1 models

> hide #!3 models

> hide #2.1 models

> show #!3 models

> show #3.1 models

> hide #3.1 models

> show #3.1 models

> hide #3.1 models

> hide #!3 models

> alphafold match #1/A

1 AlphaFold model found using sequence similarity searches: Q1G1I6 (chain A)  
AlphaFold prediction matching 6f55-assembly1.cif  
---  
Chain| UniProt Id| UniProt Name| RMSD| Length| Seen| % Id  
A | Q1G1I6 | Q1G1I6_CHICK | 1.44 | 64 | 67 | 98   
  
Opened 1 AlphaFold model  

> alphafold match #1/B

Cannot search short sequences less than 20 amino acids  

No AlphaFold model with similar sequence for chain B  

Opened 0 AlphaFold model  

> close #3-4

> select add #2.1

504 atoms, 513 bonds, 64 residues, 1 model selected  

> show #2.1 models

> select subtract #2.1

Nothing selected  
Drag select of 8 residues  

> select add #1/B:107

156 atoms, 13 bonds, 9 residues, 1 model selected  

> select add #1/B:106

170 atoms, 27 bonds, 10 residues, 1 model selected  

> select add #1/B:105

180 atoms, 36 bonds, 11 residues, 1 model selected  

> select add #1/B:104

194 atoms, 50 bonds, 12 residues, 1 model selected  

> select add #1/B:103

201 atoms, 56 bonds, 13 residues, 1 model selected  

> select add #1/B:102

223 atoms, 77 bonds, 14 residues, 1 model selected  

> select add #1/B:101

237 atoms, 90 bonds, 15 residues, 1 model selected  

> select sequence YRQHPSENKRW

Nothing selected  

> select sequence YRQHPSENKRW

Nothing selected  

> select add #1

1265 atoms, 1280 bonds, 82 residues, 1 model selected  

> select sequence YRQHPSENKRW

Nothing selected  

> alphafold match YRQHPSENKRW

Cannot search short sequences less than 20 amino acids  

No AlphaFold model with similar sequence for 1 sequences  

Opened 0 AlphaFold model  

> select sequence KGPAPNPPPILKV

199 atoms, 203 bonds, 13 residues, 1 model selected  

> select sequence TGPAPNPPPILKV

Nothing selected  

> select sequence TGPAPNPPPILKV

Nothing selected  

> select sequence TKGPAPNPPPILKV

213 atoms, 217 bonds, 14 residues, 1 model selected  

> select sequence KGPAPNPPPILKV

199 atoms, 203 bonds, 13 residues, 1 model selected  

> select sequence TKGPAPNPPPILKVI

Nothing selected  

> select sequence TKGPAPNPPPILKV

213 atoms, 217 bonds, 14 residues, 1 model selected  

> select sequence TKGPAPNPPPILKVY

Nothing selected  

> select sequence TKGPAPNPPPILKVU

Nothing selected  

> select sequence TKGPAPNPPPILKV

213 atoms, 217 bonds, 14 residues, 1 model selected  

> select sequence TKGPAPNPPPILKVW

237 atoms, 243 bonds, 15 residues, 1 model selected  

> alphafold match YRQHPSENKRW

Cannot search short sequences less than 20 amino acids  

No AlphaFold model with similar sequence for 1 sequences  

Opened 0 AlphaFold model  

> alphafold predict YRQHPSENKRW

Please cite ColabFold: Making protein folding accessible to all. Nature
Methods (2022) if you use these predictions.  
Running AlphaFold prediction  

> hide #1 models

> alphafold predict
> YRQHPSENKRW,IKVPGVRVRALYDYTGQEADELSFKAGEELMKISEEDEQGWCKGRLLTGHVGLYPANYVEKVGL

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\RyanRechnen/Downloads/ChimeraX/AlphaFold/prediction_1  

> open
> C:\Users\RyanRechnen/Downloads/ChimeraX/AlphaFold/prediction_1\best_model.pdb

Chain information for best_model.pdb #3  
---  
Chain | Description  
A | No description available  
  
Computing secondary structure  
AlphaFold prediction finished  
Results in C:\Users\RyanRechnen/Downloads/ChimeraX/AlphaFold/prediction_2  

> open
> C:\Users\RyanRechnen/Downloads/ChimeraX/AlphaFold/prediction_2\best_model.pdb

Chain information for best_model.pdb #4  
---  
Chain | Description  
A | No description available  
B | No description available  
  
Computing secondary structure  

> open
> C:/Users/RyanRechnen/Downloads/ChimeraX/AlphaFold/AF-A0A1D5PXA5-F1-model_v4.cif

Chain information for AF-A0A1D5PXA5-F1-model_v4.cif #5  
---  
Chain | Description | UniProt  
A | Transient receptor potential cation channel subfamily V member 4 | TRPV4_CHICK 1-852  
  
Color AF-A0A1D5PXA5-F1-model_v4.cif by residue attribute pLDDT_score  

> open
> C:/Users/RyanRechnen/Downloads/ChimeraX/AlphaFold/AF-Q1G1I6-F1-model_v4.cif

Chain information for AF-Q1G1I6-F1-model_v4.cif #6  
---  
Chain | Description | UniProt  
A | PACSIN 3 | Q1G1I6_CHICK 1-437  
  
Color AF-Q1G1I6-F1-model_v4.cif by residue attribute pLDDT_score  

> hide #4 models

> hide #3 models

> hide #2.1 models

> hide #!2 models

> movie record

> turn y 2 180

> wait 180

> movie encode C:\Users\RyanRechnen/Desktop\movie2.mp4

Movie saved to C:\Users\RyanRechnen/Desktop\movie2.mp4  
  

> hide #6 models

> show #6 models

> hide #5 models

> hide #6 models

> show #4 models

> show #3 models

> hide #4 models

> show #4 models

> show #2.1 models

> hide #2.1 models

> hide #!2 models

> show #!2 models

> select add #3

343 atoms, 353 bonds, 26 residues, 2 models selected  

> select add #4

952 atoms, 975 bonds, 101 residues, 3 models selected  

> select add #1

1980 atoms, 2012 bonds, 168 residues, 3 models selected  

> select subtract #1

715 atoms, 732 bonds, 86 residues, 2 models selected  

> view

> hide #!2 models

> show #!2 models

> show #1 models

> hide #!2 models

> hide #1 models

> show #1 models

> hide #1 models

> show #1 models

> hide #1 models

> hide #4 models

> show #4 models

> hide #3 models

> show #3 models

> hide #3 models

> show #3 models

> hide #3 models

> show #3 models

> show #2.1 models

> hide #2.1 models

> show #2.1 models

> hide #3 models

> hide #4 models

> show #4 models

> show #3 models

> hide #4 models

> hide #3 models

> hide #2.1 models

> hide #!2 models

> show #2.1 models

> show #1 models

> show #3 models

> show #4 models

> matchmaker #2.1 & sel to #1 & sel

No 'to' model specified  

> matchmaker #3-4#2.1 & sel to #1 & sel

No 'to' model specified  

> matchmaker #3-4#2.1 to #1

Parameters  
---  
Chain pairing | bb  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with best_model.pdb, chain A (#3),
sequence alignment score = 18.1  
RMSD between 4 pruned atom pairs is 0.806 angstroms; (across all 11 pairs:
4.208)  
  
Matchmaker 6f55-assembly1.cif, chain A (#1) with best_model.pdb, chain B (#4),
sequence alignment score = 326.2  
RMSD between 58 pruned atom pairs is 0.880 angstroms; (across all 64 pairs:
1.557)  
  
Matchmaker 6f55-assembly1.cif, chain A (#1) with AlphaFold Q1G1I6_CHICK chain
A, chain A (#2.1), sequence alignment score = 322.6  
RMSD between 57 pruned atom pairs is 0.894 angstroms; (across all 64 pairs:
1.438)  
  

> hide #!2 models

> show #!2 models

> select clear

> color #1 magenta

> color #1 #ff5500ff

> color #1 #aa00ffff

> movie record

> turn y 2 180

> wait 180

> movie encode C:\Users\RyanRechnen/Desktop\movie3.mp4

Movie saved to C:\Users\RyanRechnen/Desktop\movie3.mp4  
  

> hide #2.1 models

> hide #3 models

> hide #4 models

> hide #!2 models

> show #2.1 models

> show #3 models

> hide #3 models

> movie record

> turn y 2 180

> wait 180

> movie encode C:\Users\RyanRechnen/Desktop\movie4.mp4

Movie saved to C:\Users\RyanRechnen/Desktop\movie4.mp4  
  

> hide #!2 models

> hide #2.1 models

> show #3 models

> movie record

> turn y 2 180

> wait 180

> movie encode C:\Users\RyanRechnen/Desktop\movie5.mp4

Movie saved to C:\Users\RyanRechnen/Desktop\movie5.mp4  
  

> hide #3 models

> show #4 models

> movie record

> turn y 2 180

> wait 180

> movie encode C:\Users\RyanRechnen/Desktop\movie6.mp4

Movie saved to C:\Users\RyanRechnen/Desktop\movie6.mp4  
  

> open "I:/Chimera/AF Presentation/TRPV4 AF3/Pred AF3/nt TRPV4 bis ende PRD +
> SH3 SdpIII/tryp_chick_sh3/fold_tryp_chick_sh3_model_0.cif"

Chain information for fold_tryp_chick_sh3_model_0.cif #7  
---  
Chain | Description  
A | .  
B | .  
  
Computing secondary structure  

> alphafold pae #7 file "I:/Chimera/AF Presentation/TRPV4 AF3/Pred AF3/nt
> TRPV4 bis ende PRD + SH3
> SdpIII/tryp_chick_sh3\\\fold_tryp_chick_sh3_full_data_0.json"

> color bfactor #7 palette alphafold

1497 atoms, 193 residues, atom bfactor range 27.5 to 95.5  

> hide #4 models

> show #4 models

> matchmaker #3-4,7#2.1 to #1

Parameters  
---  
Chain pairing | bb  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with best_model.pdb, chain A (#3),
sequence alignment score = 18.1  
RMSD between 4 pruned atom pairs is 0.806 angstroms; (across all 11 pairs:
4.208)  
  
Matchmaker 6f55-assembly1.cif, chain A (#1) with best_model.pdb, chain B (#4),
sequence alignment score = 326.2  
RMSD between 58 pruned atom pairs is 0.880 angstroms; (across all 64 pairs:
1.557)  
  
Matchmaker 6f55-assembly1.cif, chain A (#1) with
fold_tryp_chick_sh3_model_0.cif, chain A (#7), sequence alignment score =
262.7  
RMSD between 53 pruned atom pairs is 0.829 angstroms; (across all 59 pairs:
1.217)  
  
Matchmaker 6f55-assembly1.cif, chain A (#1) with AlphaFold Q1G1I6_CHICK chain
A, chain A (#2.1), sequence alignment score = 322.6  
RMSD between 57 pruned atom pairs is 0.894 angstroms; (across all 64 pairs:
1.438)  
  

> alphafold predict
> VRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVECVGA,MADPEDPRDAGDVLGDDSFPLSSLANLFEVEDTPSPAEPSRGPPGAVDGKQNLRMKFHGAFRKGPPKPMELLESTIYESSVVPAPKKAPMDSLFDYGTYRQHPSENKRWRRRVVEKPVAGTKGPAPNPPPILKV

Running AlphaFold prediction  

> hide #4 models

> show #4 models

> hide #4 models

> movie record

> turn y 2 180

> wait 180

> movie encode C:\Users\RyanRechnen/Desktop\movie7.mp4

Movie saved to C:\Users\RyanRechnen/Desktop\movie7.mp4  
  

> hide #7 models

> show #4 models

> show #7 models

> movie record

> turn y 2 180

> wait 180

> movie encode C:\Users\RyanRechnen/Desktop\movie8.mp4

Movie saved to C:\Users\RyanRechnen/Desktop\movie8.mp4  
  

> alphafold contacts #4/A toAtoms #4/B distance 8

Structure best_model.pdb #4 does not have PAE data opened  

> alphafold contacts #7/A toAtoms #7/B distance 8

Found 110 residue or atom pairs within distance 8  

> show #2.1 models

> hide #2.1 models

> show #2.1 models

> hide #2.1 models

> undo

> show #!7 models

> delete alphafold contacts #7/A to #7/B distance 8

Missing or invalid "atoms" argument: invalid atoms specifier  

> delete contacts #7/A to #7/B distance 8

Missing or invalid "atoms" argument: invalid atoms specifier  

> delete #7/A to #7/B distance 8

Expected a keyword  

> delete link #7/A to #7/B distance 8

Missing or invalid "atoms" argument: invalid atoms specifier  

> close #7

> open "I:/Chimera/AF Presentation/TRPV4 AF3/Pred AF3/nt TRPV4 bis ende PRD +
> SH3 SdpIII/tryp_chick_sh3/fold_tryp_chick_sh3_model_0.cif"

Chain information for fold_tryp_chick_sh3_model_0.cif #7  
---  
Chain | Description  
A | .  
B | .  
  

> open "I:/Chimera/AF Presentation/TRPV4 AF3/Pred AF3/nt TRPV4 bis ende PRD +
> SH3 SdpIII/tryp_chick_sh3/fold_tryp_chick_sh3_model_1.cif"

Chain information for fold_tryp_chick_sh3_model_1.cif #8  
---  
Chain | Description  
A | .  
B | .  
  

> open "I:/Chimera/AF Presentation/TRPV4 AF3/Pred AF3/nt TRPV4 bis ende PRD +
> SH3 SdpIII/tryp_chick_sh3/fold_tryp_chick_sh3_model_2.cif"

Chain information for fold_tryp_chick_sh3_model_2.cif #9  
---  
Chain | Description  
A | .  
B | .  
  

> open "I:/Chimera/AF Presentation/TRPV4 AF3/Pred AF3/nt TRPV4 bis ende PRD +
> SH3 SdpIII/tryp_chick_sh3/fold_tryp_chick_sh3_model_3.cif"

Chain information for fold_tryp_chick_sh3_model_3.cif #10  
---  
Chain | Description  
A | .  
B | .  
  

> open "I:/Chimera/AF Presentation/TRPV4 AF3/Pred AF3/nt TRPV4 bis ende PRD +
> SH3 SdpIII/tryp_chick_sh3/fold_tryp_chick_sh3_model_4.cif"

Chain information for fold_tryp_chick_sh3_model_4.cif #11  
---  
Chain | Description  
A | .  
B | .  
  
Computing secondary structure  

> close #5-6

> alphafold pae #7 file "I:/Chimera/AF Presentation/TRPV4 AF3/Pred AF3/nt
> TRPV4 bis ende PRD + SH3
> SdpIII/tryp_chick_sh3\\\fold_tryp_chick_sh3_full_data_0.json"

> hide #1 models

> color bfactor #7 palette alphafold

1497 atoms, 193 residues, atom bfactor range 27.5 to 95.5  

> alphafold pae #8 file "I:/Chimera/AF Presentation/TRPV4 AF3/Pred AF3/nt
> TRPV4 bis ende PRD + SH3
> SdpIII/tryp_chick_sh3\\\fold_tryp_chick_sh3_full_data_1.json"

> alphafold pae #9 file "I:/Chimera/AF Presentation/TRPV4 AF3/Pred AF3/nt
> TRPV4 bis ende PRD + SH3
> SdpIII/tryp_chick_sh3\\\fold_tryp_chick_sh3_full_data_2.json"

> color bfactor #9 palette alphafold

1497 atoms, 193 residues, atom bfactor range 25.1 to 95.3  

> alphafold pae #10 file "I:/Chimera/AF Presentation/TRPV4 AF3/Pred AF3/nt
> TRPV4 bis ende PRD + SH3
> SdpIII/tryp_chick_sh3\\\fold_tryp_chick_sh3_full_data_3.json"

> alphafold pae #11 file "I:/Chimera/AF Presentation/TRPV4 AF3/Pred AF3/nt
> TRPV4 bis ende PRD + SH3
> SdpIII/tryp_chick_sh3\\\fold_tryp_chick_sh3_full_data_4.json"

> color bfactor #11 palette alphafold

1497 atoms, 193 residues, atom bfactor range 26.8 to 95  

> color bfactor #8 palette alphafold

1497 atoms, 193 residues, atom bfactor range 23.2 to 93.6  

> color bfactor #9 palette alphafold

1497 atoms, 193 residues, atom bfactor range 25.1 to 95.3  

> color bfactor #7 palette alphafold

1497 atoms, 193 residues, atom bfactor range 27.5 to 95.5  

> color bfactor #10 palette alphafold

1497 atoms, 193 residues, atom bfactor range 29 to 94.4  

> select sequence TKGPAPNPPPILKV

718 atoms, 742 bonds, 84 residues, 6 models selected  

> matchmaker #3-4,7-11#2.1 & sel to #1/B & sel pairing bs

Parameters  
---  
Chain pairing | bs  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_0.cif, chain B (#7), sequence alignment score = 71.4  
RMSD between 6 pruned atom pairs is 0.894 angstroms; (across all 14 pairs:
8.416)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_1.cif, chain B (#8), sequence alignment score = 56.4  
RMSD between 9 pruned atom pairs is 1.409 angstroms; (across all 14 pairs:
4.242)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_2.cif, chain B (#9), sequence alignment score = 71.4  
RMSD between 7 pruned atom pairs is 0.980 angstroms; (across all 14 pairs:
3.167)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_3.cif, chain B (#10), sequence alignment score =
71.4  
RMSD between 5 pruned atom pairs is 1.118 angstroms; (across all 14 pairs:
4.143)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_4.cif, chain B (#11), sequence alignment score =
71.4  
RMSD between 7 pruned atom pairs is 1.045 angstroms; (across all 14 pairs:
3.358)  
  

> show #!2 models

> hide #!2 models

> show #!2 models

AlphaFold prediction finished  
Results in C:\Users\RyanRechnen/Downloads/ChimeraX/AlphaFold/prediction_1  

> open
> C:\Users\RyanRechnen/Downloads/ChimeraX/AlphaFold/prediction_1\best_model.pdb

Chain information for best_model.pdb #5  
---  
Chain | Description  
A | No description available  
B | No description available  
  
Computing secondary structure  

> show #1 models

> hide #1 models

> show #1 models

> help help:user/tools/modelpanel.html

> hide #5 models

> show #5 models

> hide #5 models

> show #5 models

> hide #5 models

> show #5 models

> hide #4 models

> show #4 models

> show #3 models

> hide #3 models

> hide #4 models

> hide #7 models

> hide #8 models

> hide #9 models

> hide #10 models

> hide #11 models

> hide #!2 models

> show #!2 models

> hide #!2 models

> hide #1 models

> select sequence TKGPAPNPPPILKV

818 atoms, 846 bonds, 98 residues, 7 models selected  

> show #1 models

> show #!2 models

> show #3 models

> show #4 models

> show #7 models

> show #8 models

> show #9 models

> show #10 models

> show #11 models

> matchmaker #3-5,7-11#2.1 & sel to #1/B & sel pairing bs

Parameters  
---  
Chain pairing | bs  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_0.cif, chain B (#7), sequence alignment score = 71.4  
RMSD between 6 pruned atom pairs is 0.894 angstroms; (across all 14 pairs:
8.416)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_1.cif, chain B (#8), sequence alignment score = 56.4  
RMSD between 9 pruned atom pairs is 1.409 angstroms; (across all 14 pairs:
4.242)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_2.cif, chain B (#9), sequence alignment score = 71.4  
RMSD between 7 pruned atom pairs is 0.980 angstroms; (across all 14 pairs:
3.167)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_3.cif, chain B (#10), sequence alignment score =
71.4  
RMSD between 5 pruned atom pairs is 1.118 angstroms; (across all 14 pairs:
4.143)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_4.cif, chain B (#11), sequence alignment score =
71.4  
RMSD between 7 pruned atom pairs is 1.045 angstroms; (across all 14 pairs:
3.358)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with best_model.pdb, chain B (#5),
sequence alignment score = 71.4  
RMSD between 7 pruned atom pairs is 1.123 angstroms; (across all 14 pairs:
3.177)  
  

> hide #3 models

> hide #4 models

> hide #5 models

> hide #7 models

> hide #8 models

> hide #9 models

> hide #10 models

> hide #11 models

> lighting shadows true

> lighting shadows false

> lighting flat

> lighting shadows true intensity 0.5

> lighting simple

> lighting soft

> lighting simple

> graphics silhouettes false

> lighting simple

> show sel & #1 cartoons

> show #7 models

> show #8 models

> show #9 models

> show #10 models

> show #11 models

> show sel & #1,7-11 cartoons

> ui tool show "Model Loops"

> ui tool show "Basic Actions"

> show #7/A target c

> hide #7/A target c

> show #7/A target c

> hide #7/A target c

> show #7/A target c

> hide #7/A target c

> show #7/A target c

> ui tool show Toolbar

> ui tool show Scenes

> ui tool show "Blast Protein"

> ui autostart true "Blast Protein"

> ui favorite true "Blast Protein"

> morph #7-11

Computed 201 frame morph #6  

> coordset #6 1,201

> select sequence TKGPAPNPPPILKV

919 atoms, 951 bonds, 112 residues, 8 models selected  

> matchmaker #3-11#2.1 & sel to #1/B & sel pairing bs

Parameters  
---  
Chain pairing | bs  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_0.cif, chain B (#7), sequence alignment score = 71.4  
RMSD between 6 pruned atom pairs is 0.894 angstroms; (across all 14 pairs:
8.416)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_1.cif, chain B (#8), sequence alignment score = 56.4  
RMSD between 9 pruned atom pairs is 1.409 angstroms; (across all 14 pairs:
4.242)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_2.cif, chain B (#9), sequence alignment score = 71.4  
RMSD between 7 pruned atom pairs is 0.980 angstroms; (across all 14 pairs:
3.167)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_3.cif, chain B (#10), sequence alignment score =
71.4  
RMSD between 5 pruned atom pairs is 1.118 angstroms; (across all 14 pairs:
4.143)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with
fold_tryp_chick_sh3_model_4.cif, chain B (#11), sequence alignment score =
71.4  
RMSD between 7 pruned atom pairs is 1.045 angstroms; (across all 14 pairs:
3.358)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with best_model.pdb, chain B (#5),
sequence alignment score = 71.4  
RMSD between 7 pruned atom pairs is 1.123 angstroms; (across all 14 pairs:
3.177)  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with Morph -
fold_tryp_chick_sh3_model_0.cif, chain B (#6), sequence alignment score = 65.4  
RMSD between 7 pruned atom pairs is 1.226 angstroms; (across all 14 pairs:
2.991)  
  

> movie record

> turn y 2 180

> wait 180

> movie encode C:\Users\RyanRechnen/Desktop\movie9.mp4

Movie saved to C:\Users\RyanRechnen/Desktop\movie9.mp4  
  

> movie record

> turn y 2 180

> wait 180

> movie encode C:\Users\RyanRechnen/Desktop\movie10.mp4

Movie saved to C:\Users\RyanRechnen/Desktop\movie10.mp4  
  

> matchmaker #3-11#2.1 & sel to #1/A & sel pairing bs

No 'to' chains specified  

> select sequence VRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVECVGA

3240 atoms, 3289 bonds, 413 residues, 7 models selected  

> matchmaker #3-11#2.1 & sel to #1/A & sel pairing bs

No 'to' chains specified  

> matchmaker #6/A & sel to #1/A & sel pairing ss

No 'to' chains specified  

> matchmaker #6/A to #1/A pairing ss

Parameters  
---  
Chain pairing | ss  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker 6f55-assembly1.cif, chain A (#1) with Morph -
fold_tryp_chick_sh3_model_0.cif, chain A (#6), sequence alignment score =
255.5  
RMSD between 53 pruned atom pairs is 0.796 angstroms; (across all 59 pairs:
1.499)  
  

> save C:\Users\RyanRechnen/Desktop\image1.png supersample 3

> save C:\Users\RyanRechnen/Desktop\image2.png supersample 3

> show #5 models

> select clear

> save C:\Users\RyanRechnen/Desktop\image3.png supersample 3

> hide #5 models

> save C:\Users\RyanRechnen/Desktop\image4.png supersample 3

> save C:\Users\RyanRechnen/Desktop\image5.png supersample 3

> show #5 models

> save C:\Users\RyanRechnen/Desktop\image6.png supersample 3

> morph #5

Require at least 2 structures for morph  

> alphafold contacts #6/A toAtoms #6/B distance 8

Structure Morph - fold_tryp_chick_sh3_model_0.cif #6 does not have PAE data
opened  

> show #7 models

> alphafold contacts #7/A toAtoms #7/B distance 8

Found 110 residue or atom pairs within distance 8  

> hide #5 models

> show #5 models

> hide #!7 models

> movie record

> turn y 2 180

> wait 180

> movie encode C:\Users\RyanRechnen/Desktop\movie11.mp4

Movie saved to C:\Users\RyanRechnen/Desktop\movie11.mp4  
  

> matchmaker #6/A to #1/A pairing ss

Parameters  
---  
Chain pairing | ss  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker 6f55-assembly1.cif, chain A (#1) with Morph -
fold_tryp_chick_sh3_model_0.cif, chain A (#6), sequence alignment score =
255.5  
RMSD between 53 pruned atom pairs is 0.797 angstroms; (across all 59 pairs:
1.497)  
  

> matchmaker #6/B to #1/B pairing ss

Parameters  
---  
Chain pairing | ss  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with Morph -
fold_tryp_chick_sh3_model_0.cif, chain B (#6), sequence alignment score = 71.4  
RMSD between 6 pruned atom pairs is 1.397 angstroms; (across all 14 pairs:
4.150)  
  

> matchmaker #5/B to #1/B pairing ss

Parameters  
---  
Chain pairing | ss  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with best_model.pdb, chain B (#5),
sequence alignment score = 71.4  
RMSD between 7 pruned atom pairs is 1.123 angstroms; (across all 14 pairs:
3.177)  
  

> matchmaker #5/B to #1/B pairing ss

Parameters  
---  
Chain pairing | ss  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker 6f55-assembly1.cif, chain B (#1) with best_model.pdb, chain B (#5),
sequence alignment score = 71.4  
RMSD between 7 pruned atom pairs is 1.123 angstroms; (across all 14 pairs:
3.177)  
  

> select clear

> ui tool show "Show Sequence Viewer"

> sequence chain #7/B #8/B #9/B #10/B #11/B #5/B #6/B

Alignment identifier is 1  

> sequence chain #7/A #8/A #9/A #10/A #11/A #5/A #6/A

Alignment identifier is 2  

> sequence chain #1/A

Alignment identifier is 1/A  

> sequence chain #1/B

Alignment identifier is 1/B  

> sequence chain #2.1/A

Alignment identifier is 2.1/A  

> sequence chain #3/A#4/A

Alignment identifier is 3  

> sequence chain #4/B

Alignment identifier is 4/B  

> sequence chain #7/A#8/A#9/A#10/A#11/A#5/A#6/A

Alignment identifier is 4  

> sequence chain #7/B#8/B#9/B#10/B#11/B#5/B#6/B

Alignment identifier is 5  

> save "I:/Chimera/AF Presentation/Sequences/TRPV4 seq_predChimeraX(Colab)"
> format fasta alignment 1

> save "I:/Chimera/AF Presentation/Sequences/SH3
> seq_predChimeraX(Colab).fasta" format fasta alignment 2

> select #7/A:1 #8/A:1 #9/A:1 #10/A:1 #11/A:1 #5/A:1 #6/A:1

49 atoms, 42 bonds, 7 residues, 7 models selected  

> select #7/A #8/A #9/A #10/A #11/A #5/A #6/A

3240 atoms, 3289 bonds, 413 residues, 7 models selected  
. [ID: 2] region 7 chains [1-59] RMSD: 42.713  
  

> hide #!2 models

> hide #6 models

> select #7/A:1 #8/A:1 #9/A:1 #10/A:1 #11/A:1 #5/A:1 #6/A:1

49 atoms, 42 bonds, 7 residues, 7 models selected  

> select #7/A #8/A #9/A #10/A #11/A #5/A #6/A

3240 atoms, 3289 bonds, 413 residues, 7 models selected  
. [ID: 4] region 7 chains [1-59] RMSD: 42.713  
  

> show #6 models

> hide #5 models

> show #5 models

> select #7/B:1 #8/B:1 #9/B:1 #10/B:1 #11/B:1 #5/B:1 #6/B:1

56 atoms, 49 bonds, 7 residues, 7 models selected  

> select #7/B #8/B #9/B #10/B #11/B #5/B #6/B

7237 atoms, 7461 bonds, 938 residues, 7 models selected  
. [ID: 1] region 7 chains [1-134] RMSD: 112.725  
  

> select #7/A:1 #8/A:1 #9/A:1 #10/A:1 #11/A:1 #5/A:1 #6/A:1

49 atoms, 42 bonds, 7 residues, 7 models selected  

> select #7/A #8/A #9/A #10/A #11/A #5/A #6/A

3240 atoms, 3289 bonds, 413 residues, 7 models selected  
. [ID: 2] region 7 chains [1-59] RMSD: 42.713  
  

> hide #5 models

> show #5 models

> hide #6 models

> show #6 models

> select #7/A:1 #8/A:1 #9/A:1 #10/A:1 #11/A:1 #5/A:1 #6/A:1

49 atoms, 42 bonds, 7 residues, 7 models selected  

> select #7/A #8/A #9/A #10/A #11/A #5/A #6/A

3240 atoms, 3289 bonds, 413 residues, 7 models selected  
. [ID: 4] region 7 chains [1-59] RMSD: 42.713  
  

> hide #5 models

> show #5 models

> hide #6 models

> show #6 models

> hide #6 models

> show #6 models

> hide #6 models

> show #6 models

> select #7/A:2 #8/A:2 #9/A:2 #10/A:2 #11/A:2 #5/A:2 #6/A:2

77 atoms, 70 bonds, 7 residues, 7 models selected  

> select #7/A:2 #8/A:2 #9/A:2 #10/A:2 #11/A:2 #5/A:2 #6/A:2

77 atoms, 70 bonds, 7 residues, 7 models selected  
. [ID: 2] region 7 chains [2] RMSD: 47.597  
  

> select #7/A:1-2 #8/A:1-2 #9/A:1-2 #10/A:1-2 #11/A:1-2 #5/A:1-2 #6/A:1-2

126 atoms, 119 bonds, 14 residues, 7 models selected  

> select #7/A #8/A #9/A #10/A #11/A #5/A #6/A

3240 atoms, 3289 bonds, 413 residues, 7 models selected  
. [ID: 2] region 7 chains [1-59] RMSD: 42.713  
  

> select #7/A:25-59 #8/A:25-59 #9/A:25-59 #10/A:25-59 #11/A:25-59 #5/A:25-59
> #6/A:25-59

1889 atoms, 1917 bonds, 245 residues, 7 models selected  

> select #7/A:37-59 #8/A:37-59 #9/A:37-59 #10/A:37-59 #11/A:37-59 #5/A:37-59
> #6/A:37-59

1182 atoms, 1196 bonds, 161 residues, 7 models selected  
. [ID: 4] region 7 chains [37-59] RMSD: 43.695  
  

> select #7/A:1 #8/A:1 #9/A:1 #10/A:1 #11/A:1 #5/A:1 #6/A:1

49 atoms, 42 bonds, 7 residues, 7 models selected  

> select #7/A #8/A #9/A #10/A #11/A #5/A #6/A

3240 atoms, 3289 bonds, 413 residues, 7 models selected  
. [ID: 4] region 7 chains [1-59] RMSD: 42.713  
  


===== Log before crash end =====

Log:
UCSF ChimeraX version: 1.11.dev202508300055 (2025-08-30)  
© 2016-2025 Regents of the University of California. All rights reserved.  
How to cite UCSF ChimeraX  




OpenGL version: 3.3.0 Core Profile Context 25.8.1.250723
OpenGL renderer: AMD Radeon RX 7800 XT
OpenGL vendor: ATI Technologies Inc.

Python: 3.11.9
Locale: de_DE.cp1252
Qt version: PyQt6 6.9.1, Qt 6.9.0
Qt runtime version: 6.9.1
Qt platform: windows

Manufacturer: To Be Filled By O.E.M.
Model: To Be Filled By O.E.M.
OS: Microsoft Windows 10 Pro (Build 19045)
Memory: 137,291,546,624
MaxProcessMemory: 137,438,953,344
CPU: 12 Intel(R) Core(TM) i5-10400F CPU @ 2.90GHz
OSLanguage: de-DE

Installed Packages:
    alabaster: 1.0.0
    appdirs: 1.4.4
    asttokens: 3.0.0
    babel: 2.17.0
    beautifulsoup4: 4.13.5
    blockdiag: 3.0.0
    blosc2: 3.7.2
    build: 1.3.0
    certifi: 2025.8.3
    cftime: 1.6.4.post1
    charset-normalizer: 3.4.3
    ChimeraX-AddCharge: 1.5.20
    ChimeraX-AddH: 2.2.7
    ChimeraX-AlignmentAlgorithms: 2.0.2
    ChimeraX-AlignmentHdrs: 3.6.1
    ChimeraX-AlignmentMatrices: 2.1
    ChimeraX-Alignments: 3.0.2
    ChimeraX-AlphaFold: 1.0.1
    ChimeraX-AltlocExplorer: 1.1.2
    ChimeraX-AmberInfo: 1.0
    ChimeraX-Aniso: 1.3.2
    ChimeraX-Arrays: 1.1
    ChimeraX-Atomic: 1.60.16
    ChimeraX-AtomicLibrary: 14.1.23
    ChimeraX-AtomSearch: 2.0.1
    ChimeraX-AxesPlanes: 2.4
    ChimeraX-BasicActions: 1.1.3
    ChimeraX-BILD: 1.0
    ChimeraX-BlastProtein: 3.0.0
    ChimeraX-Boltz: 1.1
    ChimeraX-BondRot: 2.0.4
    ChimeraX-BugReporter: 1.0.2
    ChimeraX-BuildStructure: 2.13.1
    ChimeraX-Bumps: 1.0
    ChimeraX-BundleBuilder: 1.6.0
    ChimeraX-ButtonPanel: 1.0.1
    ChimeraX-CageBuilder: 1.0.1
    ChimeraX-CellPack: 1.0
    ChimeraX-Centroids: 1.4
    ChimeraX-ChangeChains: 1.1
    ChimeraX-CheckWaters: 1.5
    ChimeraX-ChemGroup: 2.0.2
    ChimeraX-Clashes: 2.3
    ChimeraX-ColorActions: 1.0.5
    ChimeraX-ColorGlobe: 1.0
    ChimeraX-ColorKey: 1.5.8
    ChimeraX-CommandLine: 1.3.0
    ChimeraX-ConnectStructure: 2.0.1
    ChimeraX-Contacts: 1.0.1
    ChimeraX-Core: 1.11.dev202508300055
    ChimeraX-CoreFormats: 1.2
    ChimeraX-coulombic: 1.4.5
    ChimeraX-Crosslinks: 1.0
    ChimeraX-Crystal: 1.0
    ChimeraX-CrystalContacts: 1.0.1
    ChimeraX-DataFormats: 1.2.4
    ChimeraX-Dicom: 1.2.7
    ChimeraX-DistMonitor: 1.4.2
    ChimeraX-DockPrep: 1.1.4
    ChimeraX-Dssp: 2.0
    ChimeraX-EMDB-SFF: 1.0
    ChimeraX-ESMFold: 1.0
    ChimeraX-FileHistory: 1.0.1
    ChimeraX-FunctionKey: 1.0.1
    ChimeraX-Geometry: 1.3
    ChimeraX-gltf: 1.0
    ChimeraX-Graphics: 1.4.1
    ChimeraX-Hbonds: 2.5.3
    ChimeraX-Help: 1.3
    ChimeraX-HKCage: 1.3
    ChimeraX-IHM: 1.1
    ChimeraX-ImageFormats: 1.2
    ChimeraX-IMOD: 1.0
    ChimeraX-IO: 1.0.4
    ChimeraX-ItemsInspection: 1.0.1
    ChimeraX-IUPAC: 1.0
    ChimeraX-KVFinder: 1.7.1
    ChimeraX-Label: 1.1.14
    ChimeraX-ListInfo: 1.2.2
    ChimeraX-Log: 1.2
    ChimeraX-LookingGlass: 1.1
    ChimeraX-Maestro: 1.9.2
    ChimeraX-Map: 1.3
    ChimeraX-MapData: 2.0
    ChimeraX-MapEraser: 1.0.1
    ChimeraX-MapFilter: 2.0.1
    ChimeraX-MapFit: 2.0
    ChimeraX-MapSeries: 2.1.1
    ChimeraX-Markers: 1.0.1
    ChimeraX-Mask: 1.0.2
    ChimeraX-MatchMaker: 2.2.2
    ChimeraX-MCopy: 1.0
    ChimeraX-MDcrds: 2.17.1
    ChimeraX-MedicalToolbar: 1.1
    ChimeraX-Meeting: 1.0.1
    ChimeraX-Minimize: 1.2
    ChimeraX-MLP: 1.1.1
    ChimeraX-mmCIF: 2.16
    ChimeraX-MMTF: 2.2
    ChimeraX-ModelArchive: 1.0
    ChimeraX-Modeller: 1.5.22
    ChimeraX-ModelPanel: 1.5.1
    ChimeraX-ModelSeries: 1.0.1
    ChimeraX-Mol2: 2.0.3
    ChimeraX-Mole: 1.0
    ChimeraX-Morph: 1.0.2
    ChimeraX-MouseModes: 1.2
    ChimeraX-Movie: 1.0.1
    ChimeraX-MutationScores: 1.0
    ChimeraX-Neuron: 1.0
    ChimeraX-Nifti: 1.2
    ChimeraX-NMRSTAR: 1.0.2
    ChimeraX-NRRD: 1.2
    ChimeraX-Nucleotides: 2.0.3
    ChimeraX-OpenCommand: 1.15.1
    ChimeraX-OrthoPick: 1.0.1
    ChimeraX-PDB: 2.7.10
    ChimeraX-PDBBio: 1.0.1
    ChimeraX-PDBLibrary: 1.0.4
    ChimeraX-PDBMatrices: 1.0
    ChimeraX-PickBlobs: 1.0.1
    ChimeraX-Positions: 1.0
    ChimeraX-PresetMgr: 1.1.3
    ChimeraX-ProfileGrids: 1.3.1
    ChimeraX-PubChem: 2.2
    ChimeraX-ReadPbonds: 1.0.1
    ChimeraX-Registration: 1.1.2
    ChimeraX-RemoteControl: 1.0
    ChimeraX-RenderByAttr: 1.6.5
    ChimeraX-RenumberResidues: 1.1
    ChimeraX-ResidueFit: 1.0.1
    ChimeraX-RestServer: 1.3.1
    ChimeraX-RNALayout: 1.0
    ChimeraX-RotamerLibMgr: 4.0
    ChimeraX-RotamerLibsDunbrack: 2.0
    ChimeraX-RotamerLibsDynameomics: 2.0
    ChimeraX-RotamerLibsRichardson: 2.0
    ChimeraX-SaveCommand: 1.5.2
    ChimeraX-Scenes: 0.2.1
    ChimeraX-SchemeMgr: 1.0
    ChimeraX-SDF: 2.0.3
    ChimeraX-Segger: 1.0
    ChimeraX-Segment: 1.0.1
    ChimeraX-Segmentations: 3.5.7
    ChimeraX-SelInspector: 1.0
    ChimeraX-SeqView: 2.17.2
    ChimeraX-Shape: 1.1
    ChimeraX-Shell: 1.0.1
    ChimeraX-Shortcuts: 1.2.1
    ChimeraX-ShowSequences: 1.0.3
    ChimeraX-SideView: 1.0.1
    ChimeraX-SimilarStructures: 1.0.1
    ChimeraX-Smiles: 2.1.2
    ChimeraX-SmoothLines: 1.0
    ChimeraX-SpaceNavigator: 1.0
    ChimeraX-StdCommands: 1.19.1
    ChimeraX-STL: 1.0.1
    ChimeraX-Storm: 1.0
    ChimeraX-StructMeasure: 1.2.1
    ChimeraX-Struts: 1.0.1
    ChimeraX-Surface: 1.0.1
    ChimeraX-SwapAA: 2.0.1
    ChimeraX-SwapRes: 2.5.2
    ChimeraX-TapeMeasure: 1.0
    ChimeraX-TaskManager: 1.0
    ChimeraX-Test: 1.0
    ChimeraX-Toolbar: 1.2.3
    ChimeraX-ToolshedUtils: 1.2.4
    ChimeraX-Topography: 1.0
    ChimeraX-ToQuest: 1.0
    ChimeraX-Tug: 1.0.1
    ChimeraX-UI: 1.48.2
    ChimeraX-Umap: 1.0
    ChimeraX-uniprot: 2.3.1
    ChimeraX-UnitCell: 1.0.1
    ChimeraX-ViewDock: 1.3.2
    ChimeraX-VIPERdb: 1.0
    ChimeraX-Vive: 1.1
    ChimeraX-VolumeMenu: 1.0.1
    ChimeraX-vrml: 1.0
    ChimeraX-VTK: 1.0
    ChimeraX-WavefrontOBJ: 1.0
    ChimeraX-WebCam: 1.0.2
    ChimeraX-WebServices: 1.1.5
    ChimeraX-Zone: 1.0.1
    colorama: 0.4.6
    comm: 0.2.3
    comtypes: 1.4.11
    contourpy: 1.3.3
    coverage: 7.10.6
    cxservices: 1.2.3
    cycler: 0.12.1
    Cython: 3.1.3
    debugpy: 1.8.16
    decorator: 5.2.1
    docutils: 0.21.2
    executing: 2.2.0
    filelock: 3.19.1
    fonttools: 4.59.2
    funcparserlib: 2.0.0a0
    glfw: 2.9.0
    grako: 3.16.5
    h5py: 3.14.0
    html2text: 2025.4.15
    idna: 3.10
    ihm: 2.2
    imagecodecs: 2024.6.1
    imagesize: 1.4.1
    iniconfig: 2.1.0
    ipykernel: 6.30.1
    ipython: 9.5.0
    ipython_pygments_lexers: 1.1.1
    ipywidgets: 8.1.7
    jedi: 0.19.2
    Jinja2: 3.1.6
    jupyter_client: 8.6.3
    jupyter_core: 5.8.1
    jupyterlab_widgets: 3.0.15
    kiwisolver: 1.4.9
    line_profiler: 5.0.0
    lxml: 6.0.1
    lz4: 4.3.2
    Markdown: 3.8.2
    MarkupSafe: 3.0.2
    matplotlib: 3.10.5
    matplotlib-inline: 0.1.7
    msgpack: 1.1.1
    ndindex: 1.10.0
    nest-asyncio: 1.6.0
    netCDF4: 1.6.5
    networkx: 3.3
    nibabel: 5.2.0
    nptyping: 2.5.0
    numexpr: 2.11.0
    numpy: 1.26.4
    nvidia-nvjitlink-cu12: 12.9.86
    OpenMM: 8.2.0
    OpenMM-CUDA-12: 8.2.0
    openvr: 1.26.701
    packaging: 25.0
    ParmEd: 4.2.2
    parso: 0.8.5
    pep517: 0.13.1
    pickleshare: 0.7.5
    pillow: 11.3.0
    pip: 25.2
    pkginfo: 1.12.1.2
    platformdirs: 4.4.0
    pluggy: 1.6.0
    prompt_toolkit: 3.0.52
    psutil: 7.0.0
    pure_eval: 0.2.3
    py-cpuinfo: 9.0.0
    pybind11: 3.0.1
    pycollada: 0.8
    pydicom: 2.4.4
    Pygments: 2.18.0
    pynmrstar: 3.3.5
    pynrrd: 1.0.0
    PyOpenGL: 3.1.10
    PyOpenGL-accelerate: 3.1.10
    pyopenxr: 1.1.4501
    pyparsing: 3.2.3
    pyproject_hooks: 1.2.0
    PyQt6-commercial: 6.9.1
    PyQt6-Qt6: 6.9.1
    PyQt6-WebEngine-commercial: 6.9.0
    PyQt6-WebEngine-Qt6: 6.9.1
    PyQt6_sip: 13.10.2
    pytest: 8.4.1
    pytest-cov: 6.2.1
    python-dateutil: 2.9.0.post0
    pytz: 2025.2
    pywin32: 311
    pyzmq: 27.0.2
    qtconsole: 5.6.1
    QtPy: 2.4.3
    qtshim: 1.2
    RandomWords: 0.4.0
    requests: 2.32.4
    roman-numerals-py: 3.1.0
    scipy: 1.14.0
    setuptools: 80.9.0
    sfftk-rw: 0.8.1
    six: 1.17.0
    snowballstemmer: 3.0.1
    sortedcontainers: 2.4.0
    soupsieve: 2.8
    Sphinx: 8.2.3
    sphinx-autodoc-typehints: 3.2.0
    sphinxcontrib-applehelp: 2.0.0
    sphinxcontrib-blockdiag: 3.0.0
    sphinxcontrib-devhelp: 2.0.0
    sphinxcontrib-htmlhelp: 2.1.0
    sphinxcontrib-jsmath: 1.0.1
    sphinxcontrib-qthelp: 2.0.0
    sphinxcontrib-serializinghtml: 2.0.0
    stack-data: 0.6.3
    superqt: 0.7.6
    tables: 3.10.2
    tcia_utils: 1.5.1
    tifffile: 2025.3.13
    tinyarray: 1.2.5
    tornado: 6.5.2
    traitlets: 5.14.3
    typing_extensions: 4.15.0
    tzdata: 2025.2
    urllib3: 2.5.0
    wcwidth: 0.2.13
    webcolors: 24.11.1
    wheel: 0.45.1
    wheel-filename: 1.4.2
    widgetsnbextension: 4.0.14
    WMI: 1.5.1

Change History (2)

comment:1 by Eric Pettersen, 11 months ago

Cc: Tom Goddard added
Component: UnassignedCore
Owner: set to Eric Pettersen
Platform: all
Project: ChimeraX
Status: newaccepted
Summary: ChimeraX bug report submissionCrash in event loop

comment:2 by Eric Pettersen, 11 months ago

Resolution: can't reproduce
Status: acceptedclosed
Note: See TracTickets for help on using tickets.