Opened 23 months ago
Closed 23 months ago
#15484 closed defect (can't reproduce)
Crash no Python or C stack traces, after running AlphaFold prediction
| Reported by: | Owned by: | Tom Goddard | |
|---|---|---|---|
| Priority: | normal | Milestone: | |
| Component: | Structure Prediction | Version: | |
| Keywords: | Cc: | ||
| Blocked By: | Blocking: | ||
| Notify when closed: | Platform: | all | |
| Project: | ChimeraX |
Description
The following bug report has been submitted:
Platform: macOS-11.7.10-x86_64-i386-64bit
ChimeraX Version: 1.8 (2024-06-10 23:15:52 UTC)
Description
Last time you used ChimeraX it crashed.
Please describe steps that led to the crash here.
Process: ChimeraX [1645]
Path: /private/var/folders/*/ChimeraX-1.8.app/Contents/MacOS/ChimeraX
Identifier: edu.ucsf.cgl.ChimeraX
Version: ???
Code Type: X86-64 (Native)
Parent Process: ??? [1]
Responsible: ChimeraX [1645]
User ID: 501
Date/Time: 2024-06-20 18:03:07.015 -0400
OS Version: macOS 11.7.10 (20G1427)
Report Version: 12
Anonymous UUID: FCDDA036-C5B4-36FE-D719-51D652E088E7
Time Awake Since Boot: 2400 seconds
System Integrity Protection: enabled
Crashed Thread: Unknown
Exception Type: EXC_BAD_ACCESS (SIGBUS)
Exception Codes: KERN_MEMORY_ERROR at 0x000000010d010000
Exception Note: EXC_CORPSE_NOTIFY
Termination Signal: Bus error: 10
Termination Reason: Namespace SIGNAL, Code 0xa
Terminating Process: exc handler [1645]
VM Regions Near 0x10d010000:
--> mapped file 10d010000-10d014000 [ 16K] r-x/r-x SM=COW Object_id=a59380ff
mapped file 10d014000-10d018000 [ 16K] rw-/rw- SM=COW Object_id=a59380ff
Backtrace not available
Unknown thread crashed with X86 Thread State (64-bit):
rax: 0x0000000113535a90 rbx: 0x00007ffee2bef8f8 rcx: 0x000000000000000c rdx: 0x00007ffee2bef8c8
rdi: 0x000000010d010000 rsi: 0x00007ffee2bef918 rbp: 0x00007ffee2bef8b0 rsp: 0x00007ffee2bef870
r8: 0x0000000000000073 r9: 0x0000000113497000 r10: 0x0000000000000010 r11: 0x0000000000000206
r12: 0x00007ffee2bef8c8 r13: 0x000000010d010000 r14: 0x00007ffee2bef918 r15: 0x000000010d010000
rip: 0x00000001134c7781 rfl: 0x0000000000010202 cr2: 0x000000010d010000
Logical CPU: 1
Error Code: 0x00000004 (no mapping for user data read)
Trap Number: 14
Unknown thread instruction stream:
c3 55 48 89 e5 83 7f 0c-05 0f 94 c0 5d c3 90 55 .UH.........]..U
48 89 e5 b9 08 00 00 00-48 8d 15 90 e5 06 00 48 H.......H......H
8d 05 d2 2f 06 00 39 3c-11 74 0f 48 83 c1 10 48 .../..9 open "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1 and
> PRM2/selected_prediction.pdb"
Chain information for selected_prediction.pdb #1
---
Chain | Description
A | No description available
B | No description available
C | No description available
> nucleotides atoms
> style nucleic stick
Changed 0 atom styles
> sequence chain #1/A
Alignment identifier is 1/A
> select add #1
38153 atoms, 38549 bonds, 2376 residues, 1 model selected
> select subtract #1
Nothing selected
> select add #1
38153 atoms, 38549 bonds, 2376 residues, 1 model selected
> select subtract #1
Nothing selected
> show target m
> color bychain
> mlp
Map values for surface "selected_prediction.pdb_A SES surface": minimum
-28.57, mean -3.834, maximum 26.88
Map values for surface "selected_prediction.pdb_B SES surface": minimum
-23.46, mean -4.006, maximum 20.78
Map values for surface "selected_prediction.pdb_C SES surface": minimum
-22.74, mean -4.66, maximum 22.28
To also show corresponding color key, enter the above mlp command and add key
true
> mlp
Map values for surface "selected_prediction.pdb_A SES surface": minimum
-28.57, mean -3.834, maximum 26.88
Map values for surface "selected_prediction.pdb_B SES surface": minimum
-23.46, mean -4.006, maximum 20.78
Map values for surface "selected_prediction.pdb_C SES surface": minimum
-22.74, mean -4.66, maximum 22.28
To also show corresponding color key, enter the above mlp command and add key
true
> undo
> redo
> select
> /A:34-40,65-69,221-226,246-252,316-322,369-373,521-524,784-788,806-810,818-823,831-839,1019-1023,1030-1038,1045-1053,1058-1066,1069-1076,1119-1125,1131-1134,1226-1228,1234-1241,1254-1261,1282-1287,1293-1297,1302-1305,1311-1314,1392-1396,1402-1406,1409-1411,1419-1423,1430-1434,1439-1442,1448-1451,1457-1468,1483-1494,1500-1504,1510-1513,1519-1522,1528-1531,1537-1540,1546-1549,1570-1573,1579-1584,1590-1594,1599-1602,1641-1645,1651-1655,1674-1679,1687-1694,1762-1770,2076-2079,2083-2089,2093-2102,2110-2112,2121-2125,2135-2143,2155-2166,2169-2180,2201-2203
5874 atoms, 5875 bonds, 352 residues, 1 model selected
> hide target m
> show target m
> mlp sel
Map values for surface "selected_prediction.pdb_A SES surface": minimum
-28.57, mean -3.834, maximum 26.88
To also show corresponding color key, enter the above mlp command and add key
true
> select add #1
38153 atoms, 38549 bonds, 2376 residues, 2 models selected
> select subtract #1
3 models selected
> color bychain
> alphafold contacts /A toAtoms /B distance 8
Structure selected_prediction.pdb #1 does not have PAE data opened
> open "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1 and
> PRM2/predicted_aligned_error.json"
Opened AlphaFold PAE with values for 2376 residues and atoms
> alphafold contacts /A toAtoms /B distance 8
Found 511 residue or atom pairs within distance 8
> style ball
Changed 38153 atom styles
> save "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1 and
> PRM2/test1.cxs"
> select add #1
38153 atoms, 38549 bonds, 511 pseudobonds, 2376 residues, 2 models selected
> select subtract #1
3 models selected
> show target m
> color bychain
> select /A:181-270
1402 atoms, 1414 bonds, 90 residues, 1 model selected
> select /A:181-405
3587 atoms, 3625 bonds, 225 residues, 1 model selected
> undo
> redo
> undo
> select
> /A:13-16,18-23,44-58,70-87,104-114,122-152,154-157,159-162,206-208,231-239,256-270,275-304,311-314,324-326,334-367,427-433,438-440,443-458,464-466,478-490,495-505,508-511,528-535,544-554,556-561,571-585,592-605,639-667,768-774,790-802,846-853,858-891,942-945,948-951,1149-1155,1263-1267,1269-1272,1278-1280,1561-1567,1610-1612,1624-1629,1657-1669,1776-1802,1811-1825,1832-1854,1866-1872,1887-1902,1915-1917,1919-1922,2063-2065,2117-2119,2149-2151,2182-2187
9284 atoms, 9317 bonds, 559 residues, 1 model selected
> save "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1 and
> PRM2/Joint.cxs"
> show #!1 target m
> ui tool show "Show Sequence Viewer"
> sequence chain /B
Alignment identifier is 1/B
> ui tool show "Show Sequence Viewer"
> sequence chain /C
Alignment identifier is 1/C
> coulombic sel
Using Amber 20 recommended default charges and atom types for standard
residues
Coulombic values for selected_prediction.pdb_A SES surface #1.1: minimum,
-20.73, mean -1.75, maximum 23.10
To also show corresponding color key, enter the above coulombic command and
add key true
> undo
> show #!1 target m
> select /B:10-12,14-19
183 atoms, 183 bonds, 9 residues, 1 model selected
> color sel bychain
> alphafold contacts /A toAtoms /B toAtoms C/ distance 8
Invalid "toAtoms" argument: only initial part "C" of atom specifier valid
> select add #1
38153 atoms, 38549 bonds, 511 pseudobonds, 2376 residues, 3 models selected
> select subtract #1
3 models selected
> style ball
Changed 38153 atom styles
Color zone shortcut requires 1 displayed atomic model and 1 map, got 1 atomic
models, 0 maps.
Fit in map shortcut requires 1 displayed atomic model and 1 map or two maps,
got 1 atomic models, 0 maps.
> show atoms
> show cartoons
> show surfaces
> show target m
> select add #1
38153 atoms, 38549 bonds, 511 pseudobonds, 2376 residues, 2 models selected
> select subtract #1
3 models selected
> ui tool show Contacts
> contacts ignoreHiddenModels true
20334 contacts
> ui tool show "Dock Prep"
Starting dock prep
Deleting solvent
Deleting non-metal-complex ions
Deleting non-current alt locs
Summary of feedback from adding hydrogens to selected_prediction.pdb #1
---
notes | No usable SEQRES records for selected_prediction.pdb (#1) chain A; guessing termini instead
No usable SEQRES records for selected_prediction.pdb (#1) chain B; guessing
termini instead
No usable SEQRES records for selected_prediction.pdb (#1) chain C; guessing
termini instead
Chain-initial residues that are actual N termini: /A MET 1, /B MET 1, /C MET 1
Chain-initial residues that are not actual N termini:
Chain-final residues that are actual C termini: /A HIS 2223, /B HIS 51, /C HIS
102
Chain-final residues that are not actual C termini:
1613 hydrogen bonds
0 hydrogens added
Closest equivalent command: addcharge standardizeResidues none
Using Amber 20 recommended default charges and atom types for standard
residues
Dock prep finished
Must select at least one chain from each list
> interfaces select /C & ::polymer_type>0 contacting /A & ::polymer_type>0
> areaCutoff 0
18 contacting residues
> sequence associate /A 1/B
Associated selected_prediction.pdb chain A to chain B with 49 mismatches
and/or gaps
> sequence disassociate /B 1/B
Disassociated selected_prediction.pdb chain B from chain B
> sequence associate /B 1/B
Associated selected_prediction.pdb chain B to chain B with 0 mismatches
> save "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1 and
> PRM2/SPAG17_prm1_2.cxs"
> select /B:9-51
821 atoms, 826 bonds, 506 pseudobonds, 43 residues, 2 models selected
> select /A:2217,2219-2223/B:2,4-8
193 atoms, 192 bonds, 18 pseudobonds, 12 residues, 2 models selected
> select /B:9-51
821 atoms, 826 bonds, 506 pseudobonds, 43 residues, 2 models selected
> select /A:2217,2219-2223/B:2,4-8
193 atoms, 192 bonds, 18 pseudobonds, 12 residues, 2 models selected
> ui tool show "AlphaFold Error Plot"
> alphafold pae #1 file "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1
> and PRM2/predicted_aligned_error.json"
> color /A:1386-1823 lime
> color /A:1818-2063 lime
> save "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1 and
> PRM2/SPAG17_prm1_2_2.cxs"
> close session
> ui tool show AlphaFold
> toolshed show
> alphafold predict
> MAPKKEKGGTVNTSSKIWEPSLIAAQFNQNDWQASIAFVVGNQIEDDLLIQALTVAVQVPQRKLFSMVSWQDILQQINEINTLVGSASSKKAKKPVGGNAPLYYEVLTAAKAIMDSGEKLTLPLIGKLLKFQLLQIKFKDQQRRENEKKVIEDKPKLEKDKGKAKSPKEKKAPSAKPAKGKGKDQPEANAPVKKTTQLKRRGEDDHTNRYIDDEPDDGAQHYIIVVGFNNPQLLAIMAELGIPITSVIKISSENYEPLQTHLAAVNQQQEVLLQSEDLEAEKLKKENAIKELKTFWKYLEPVLNNEKPETNLFDVARLEYMVKAADFPSDWSDGEMMLKLGTDIFENIACLMYDILDWKRQHQHYLESMQLINVPQVVNEKPVLEAMPTSEAPQPAVPAPGKKKAQYEEPQAPPPVTSVITTEVDMRYYNYLLNPIREEFISVPLILHCMLEQVVATEEDLVPPSLREPSPRADGLDHRIAAHIVSLLPSLCLSEREKKNLHDIFLSEEENESKAVPKGPLLLNYHDAHAHKKYALQDQKNFDPVQIEQEMQSKLPLWEFLQFPLPPPWNNTKRLATIHELMHFCTSDVLSWNEVERAFKVFTFESLKLSEVDEKGKLKPSGMMCGSDSEMFNIPWDNPARFAKQIRQQYVMKMNTQEAKQKADIKIKDRTLFVDQNLSMSVQDNESNREPSDPSQCDANNMKHSDLNNLKLSVPDNRQLLEQESIMKAQPQHESLEQTTNNEIKDDAVTKADSHEKKPKKMMVEADLEDIKKTQQRSLMDWSFTEHFKPKVLLQVLQEAHKQYRCVDSYYHTQDNSLLLVFHNPMNRQRLHCEYWNIALHSNVGFRNYLELVAKSIQDWITKEEAIYQESKMNEKIIRTRAELELKSSANAKLTSASKIFSIKESKSNKGISKTEISDQEKEKEKEKIPFILEGSLKAWKEEQHRLAEEERLREEKKAEKKGKEAGKKKGKDNAEKEDSRSLKKKSPYKEKSKEEQVKIQEVTEESPHQPEPKITYPFHGYNMGNIPTQISGSNYYLYPSDGGQIEVEKTMFEKGPTFIKVRVVKDNHNFMIHLNDPKEIVKKEEKGDYYLEEEEEGDEEQSLETEVSDAKNKAFSKFGSFSATLENGICLSISYYGSNGMAPEDKDPDLETILNIPSALTPTVVPVIVTVPQSKAKGKIKGKEKPKESLKEEEHPKEEEKKEEEVEPEPVLQETLDVPTFQSLNVSCPSGLLLTFIGQESTGQYVIDEEPTWDIMVRQSYPQRVKHYEFYKTVMPPAEQEASRVITSQGTVVKYMLDGSTQILFADGAVSRSPNSGLICPPSEMPATPHSGDLMDSISQQKSETIPSEITNTKKGKSHKSQSSMAHKGEIHDPPPEAVQTVTPVEVHIGTWFTTTPEGNRIGTKGLERIADLTPLLSFQATDPVNGTVMTTREDKVVIVERKDGTRIVDHADGTRITTFYQVYEDQIILPDDQETTEGPRTVTRQVKCMRVESSRYATVIANCEDSSCCATFGDGTTIIAKPQGTYQVLPPNTGSLYIDKDCSAVYCHESSSNIYYPFQKREQLRAGRYIMRHTSEVICEVLDPEGNTFQVMADGSISTILPEKKLEDDLNEKTEGYDSLSSMHLEKNHQQIYGEHVPRFFVMYADGSGMELLRDSDIEEYLSLAYKESNTVVLQEPVQEQPGTLTITVLRPFHEASPWQVKKEDTIVPPNLRSRSWETFPSVEKKTPGPPFGTQIWKGLCIESKQLVSAPGAILKSPSVLQMRQFIQHEVIKNEVKLRLQVSLKDYINYILKKEDELQEMMVKDSRTEEERGNAADLLKLVMSFPKMEETTKSHVTEVAAHLTDLFKQSLATPPKCPPDTFGKDFFEKTWRHTASSKRWKEKIDKTRKEIETTQNYLMDIKNRIIPPFFKSELNQLYQSQYNHLDSLSKKLPSFTKKNEDANETAVQDTSDLNLDFKPHKVSEQKSSSVPSLPKPEISADKKDFTAQNQTENLTKSPEEAESYEPVKIPTQSLLQDVAGQTRKEKVKLPHYLLSSKPKSQPLAKVQDSVGGKVNTSSVASAAINNAKSSLFGFHLLPSSVKFGVLKEGHTYATVVKLKNVGVDFCRFKVKQPPPSTGLKVTYKPGPVAAGMQTELNIELFATAVGEDGAKGSAHISHNIEIMTEHEVLFLPVEATVLTSSNYDKRPKDFPQGKENPMVQRTSTIYSSTLGVFMSRKVSPH:MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF
Missing or invalid "sequences" argument: Sequences argument
"MAPKKEKGGTVNTSSKIWEPSLIAAQFNQNDWQASIAFVVGNQIEDDLLIQALTVAVQVPQRKLFSMVSWQDILQQINEINTLVGSASSKKAKKPVGGNAPLYYEVLTAAKAIMDSGEKLTLPLIGKLLKFQLLQIKFKDQQRRENEKKVIEDKPKLEKDKGKAKSPKEKKAPSAKPAKGKGKDQPEANAPVKKTTQLKRRGEDDHTNRYIDDEPDDGAQHYIIVVGFNNPQLLAIMAELGIPITSVIKISSENYEPLQTHLAAVNQQQEVLLQSEDLEAEKLKKENAIKELKTFWKYLEPVLNNEKPETNLFDVARLEYMVKAADFPSDWSDGEMMLKLGTDIFENIACLMYDILDWKRQHQHYLESMQLINVPQVVNEKPVLEAMPTSEAPQPAVPAPGKKKAQYEEPQAPPPVTSVITTEVDMRYYNYLLNPIREEFISVPLILHCMLEQVVATEEDLVPPSLREPSPRADGLDHRIAAHIVSLLPSLCLSEREKKNLHDIFLSEEENESKAVPKGPLLLNYHDAHAHKKYALQDQKNFDPVQIEQEMQSKLPLWEFLQFPLPPPWNNTKRLATIHELMHFCTSDVLSWNEVERAFKVFTFESLKLSEVDEKGKLKPSGMMCGSDSEMFNIPWDNPARFAKQIRQQYVMKMNTQEAKQKADIKIKDRTLFVDQNLSMSVQDNESNREPSDPSQCDANNMKHSDLNNLKLSVPDNRQLLEQESIMKAQPQHESLEQTTNNEIKDDAVTKADSHEKKPKKMMVEADLEDIKKTQQRSLMDWSFTEHFKPKVLLQVLQEAHKQYRCVDSYYHTQDNSLLLVFHNPMNRQRLHCEYWNIALHSNVGFRNYLELVAKSIQDWITKEEAIYQESKMNEKIIRTRAELELKSSANAKLTSASKIFSIKESKSNKGISKTEISDQEKEKEKEKIPFILEGSLKAWKEEQHRLAEEERLREEKKAEKKGKEAGKKKGKDNAEKEDSRSLKKKSPYKEKSKEEQVKIQEVTEESPHQPEPKITYPFHGYNMGNIPTQISGSNYYLYPSDGGQIEVEKTMFEKGPTFIKVRVVKDNHNFMIHLNDPKEIVKKEEKGDYYLEEEEEGDEEQSLETEVSDAKNKAFSKFGSFSATLENGICLSISYYGSNGMAPEDKDPDLETILNIPSALTPTVVPVIVTVPQSKAKGKIKGKEKPKESLKEEEHPKEEEKKEEEVEPEPVLQETLDVPTFQSLNVSCPSGLLLTFIGQESTGQYVIDEEPTWDIMVRQSYPQRVKHYEFYKTVMPPAEQEASRVITSQGTVVKYMLDGSTQILFADGAVSRSPNSGLICPPSEMPATPHSGDLMDSISQQKSETIPSEITNTKKGKSHKSQSSMAHKGEIHDPPPEAVQTVTPVEVHIGTWFTTTPEGNRIGTKGLERIADLTPLLSFQATDPVNGTVMTTREDKVVIVERKDGTRIVDHADGTRITTFYQVYEDQIILPDDQETTEGPRTVTRQVKCMRVESSRYATVIANCEDSSCCATFGDGTTIIAKPQGTYQVLPPNTGSLYIDKDCSAVYCHESSSNIYYPFQKREQLRAGRYIMRHTSEVICEVLDPEGNTFQVMADGSISTILPEKKLEDDLNEKTEGYDSLSSMHLEKNHQQIYGEHVPRFFVMYADGSGMELLRDSDIEEYLSLAYKESNTVVLQEPVQEQPGTLTITVLRPFHEASPWQVKKEDTIVPPNLRSRSWETFPSVEKKTPGPPFGTQIWKGLCIESKQLVSAPGAILKSPSVLQMRQFIQHEVIKNEVKLRLQVSLKDYINYILKKEDELQEMMVKDSRTEEERGNAADLLKLVMSFPKMEETTKSHVTEVAAHLTDLFKQSLATPPKCPPDTFGKDFFEKTWRHTASSKRWKEKIDKTRKEIETTQNYLMDIKNRIIPPFFKSELNQLYQSQYNHLDSLSKKLPSFTKKNEDANETAVQDTSDLNLDFKPHKVSEQKSSSVPSLPKPEISADKKDFTAQNQTENLTKSPEEAESYEPVKIPTQSLLQDVAGQTRKEKVKLPHYLLSSKPKSQPLAKVQDSVGGKVNTSSVASAAINNAKSSLFGFHLLPSSVKFGVLKEGHTYATVVKLKNVGVDFCRFKVKQPPPSTGLKVTYKPGPVAAGMQTELNIELFATAVGEDGAKGSAHISHNIEIMTEHEVLFLPVEATVLTSSNYDKRPKDFPQGKENPMVQRTSTIYSSTLGVFMSRKVSPH:MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF"
is not a chain specifier, alignment id, UniProt id, or sequence characters
> open "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1 and
> PRM2/SPAG17_prm1_2_2.cxs" format session
opened ChimeraX session
> alphafold contacts /A toAtoms C/ distance 8
Invalid "toAtoms" argument: only initial part "C" of atom specifier valid
> alphafold contacts to C/ distance 8
Missing or invalid "atoms" argument: invalid atoms specifier
> alphafold contacts A/ to C/ distance 8
Missing or invalid "atoms" argument: invalid atoms specifier
> interfaces select & ~solvent
Missing or invalid "atoms" argument: invalid atoms specifier
> alphafold contacts A/ to B/ to C/ distance 8
Missing or invalid "atoms" argument: invalid atoms specifier
> interfaces select & ~solvent
Missing or invalid "atoms" argument: invalid atoms specifier
> select /A
35362 atoms, 35734 bonds, 17853 pseudobonds, 2223 residues, 2 models selected
> alphafold contacts A/ to B/ to C/ distance 8
Missing or invalid "atoms" argument: invalid atoms specifier
> alphafold contacts A/ to C/ distance 8
Missing or invalid "atoms" argument: invalid atoms specifier
> alphafold contacts /A toAtoms /C distance 8
Structure selected_prediction.pdb #1 does not have PAE data opened
Color zone shortcut requires 1 displayed atomic model and 1 map, got 1 atomic
models, 0 maps.
Fit in map shortcut requires 1 displayed atomic model and 1 map or two maps,
got 1 atomic models, 0 maps.
> interfaces select & ~solvent
Missing or invalid "atoms" argument: invalid atoms specifier
> close
> ui tool show AlphaFold
> open "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1 and
> PRM2/SPAG17_prm1_2_2.cxs" format session
opened ChimeraX session
> ui tool show "AlphaFold Error Plot"
> alphafold pae #1 file "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1
> and PRM2/predicted_aligned_error.json"
> conects /A to /C distance 6
Unknown command: alphafold conects /A to /C distance 6
> conects /A to /C distance 8
Unknown command: alphafold conects /A to /C distance 8
> alphafold contacts /A toAtoms /C distance 8
Found 358 residue or atom pairs within distance 8
Destroying pre-existing alignment with identifier 1/A
Alignment identifier is 1/A
Destroying pre-existing alignment with identifier 1/B
Alignment identifier is 1/B
> show target m
> interfaces select & ~solvent
Missing or invalid "atoms" argument: invalid atoms specifier
> show sel atoms
> hbonds sel reveal true
9 hydrogen bonds found
> interfaces select & ~solvent
Missing or invalid "atoms" argument: invalid atoms specifier
> label (#!1 & sel) attribute label_specifier
> interfaces select & ~solvent
Missing or invalid "atoms" argument: invalid atoms specifier
> label (#!1 & sel) text "/{0.chain_id} {0.label_one_letter_code}
> {0.number}{0.insertion_code}"
> save "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1 and
> PRM2/SPAG17_prm1_2_3.cxs"
> select down
193 atoms, 192 bonds, 18 pseudobonds, 12 residues, 2 models selected
> ~hbonds
> style sel ball
Changed 193 atom styles
> view /A:747
> label (#!1 & sel) text "/{0.chain_id} {0.label_one_letter_code}
> {0.number}{0.insertion_code}"
> label (#!1 & sel) attribute label_specifier
Destroying pre-existing alignment with identifier 1/A
Alignment identifier is 1/A
Destroying pre-existing alignment with identifier 1/B
Alignment identifier is 1/B
> undo
> show sel atoms
> ui tool show "Show Sequence Viewer"
> ui tool show ViewDockX
No suitable models found for ViewDockX
> toolshed show
> view /A:749
> show (#!1 & sel) target ab
> style (#!1 & sel) stick
Changed 193 atom styles
> show (#!1 & sel-residues & sidechain) target ab
> view sel
> undo
> select
> /A:13-16,18-23,44-58,70-87,104-114,122-152,154-157,159-162,206-208,231-239,256-270,275-304,311-314,324-326,334-367,427-433,438-440,443-458,464-466,478-490,495-505,508-511,528-535,544-554,556-561,571-585,592-605,639-667,768-774,790-802,846-853,858-891,942-945,948-951,1149-1155,1263-1267,1269-1272,1278-1280,1561-1567,1610-1612,1624-1629,1657-1669,1776-1802,1811-1825,1832-1854,1866-1872,1887-1902,1915-1917,1919-1922,2063-2065,2117-2119,2149-2151,2182-2187
9284 atoms, 9317 bonds, 4116 pseudobonds, 559 residues, 2 models selected
> select
> /A:13-16,18-23,44-58,70-87,104-114,122-152,154-157,159-162,206-208,231-239,256-270,275-304,311-314,324-326,334-367,427-433,438-440,443-458,464-466,478-490,495-505,508-511,528-535,544-554,556-561,571-585,592-605,639-667,768-774,790-802,846-853,858-891,942-945,948-951,1149-1155,1263-1267,1269-1272,1278-1280,1561-1567,1610-1612,1624-1629,1657-1669,1776-1802,1811-1825,1832-1854,1866-1872,1887-1902,1915-1917,1919-1922,2063-2065,2117-2119,2149-2151,2182-2187
9284 atoms, 9317 bonds, 4116 pseudobonds, 559 residues, 2 models selected
> undo
> hide #* target a
> show (#!1 & sel) target ab
> undo
Drag select of selected_prediction.pdb_A SES surface, 73163 of 3586690
triangles, selected_prediction.pdb_C SES surface, 63322 of 269958 triangles,
59 residues, 89 pseudobonds
> show (#!1 & sel) target ab
> view sel
> undo
> show (#!1 & sel) target ab
> label (#!1 & sel) text "/{0.chain_id} {0.label_one_letter_code}
> {0.number}{0.insertion_code}"
> style sel ball
Changed 990 atom styles
> style sel ball
Changed 990 atom styles
> style (#!1 & sel) ball
Changed 990 atom styles
> select clear
Drag select of selected_prediction.pdb_A SES surface, 304181 of 3586690
triangles, selected_prediction.pdb_C SES surface, 32262 of 269958 triangles,
223 residues, 842 pseudobonds
> label (#!1 & sel) text "/{0.chain_id} {0.label_one_letter_code}
> {0.number}{0.insertion_code}"
> undo
> redo
> ~label (#!1 & sel) residues
> undo
Drag select of selected_prediction.pdb_A SES surface, 21800 of 3586690
triangles, selected_prediction.pdb_C SES surface, 3846 of 269958 triangles, 25
residues, 87 pseudobonds
Drag select of selected_prediction.pdb_A SES surface, 54367 of 3586690
triangles, selected_prediction.pdb_C SES surface, 9787 of 269958 triangles, 45
residues, 236 pseudobonds
> undo
Drag select of selected_prediction.pdb_A SES surface, 351675 of 3586690
triangles, selected_prediction.pdb_C SES surface, 32324 of 269958 triangles,
272 residues, 988 pseudobonds
> show (#!1 & sel-residues & sidechain) target ab
> show (#!1 & sel) target ab
> view sel
> undo
> show (#!1 & sel) target ab
> save "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1 and
> PRM2/SPAG17_prm1_2_4.cxs"
> close session
> open "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1 and
> PRM2/selected_prediction.pdb" format pdb
Chain information for selected_prediction.pdb #1
---
Chain | Description
A | No description available
B | No description available
C | No description available
> color bychain
Drag select of 211 residues
> style sel ball
Changed 3517 atom styles
> sequence chain #1/A
Alignment identifier is 1/A
> select /B:1-51
965 atoms, 971 bonds, 51 residues, 1 model selected
> select /A:1-2223
35362 atoms, 35734 bonds, 2223 residues, 1 model selected
> select /B:1-51
965 atoms, 971 bonds, 51 residues, 1 model selected
> undo
> alphafold contacts /A toAtoms /C distance 8
Structure selected_prediction.pdb #1 does not have PAE data opened
> ui tool show "AlphaFold Error Plot"
> alphafold pae #1 file "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1
> and PRM2/predicted_aligned_error.json"
> alphafold contacts /A toAtoms /C distance 8
Found 358 residue or atom pairs within distance 8
Drag select of 17 residues, 19 pseudobonds
> ui tool show "Show Sequence Viewer"
> sequence chain /B
Alignment identifier is 1/B
> ui tool show "Show Sequence Viewer"
> sequence chain /C
Alignment identifier is 1/C
> show (#!1 & sel) target ab
> label (#!1 & sel) text "{0.label_one_letter_code}
> {0.number}{0.insertion_code}"
> undo
> redo
> label (#!1 & sel) text "/{0.chain_id} {0.label_one_letter_code}
> {0.number}{0.insertion_code}"
Drag select of 26 residues, 42 pseudobonds
> show (#!1 & sel) target ab
> label (#!1 & sel) text "/{0.chain_id} {0.label_one_letter_code}
> {0.number}{0.insertion_code}"
Drag select of 275 residues, 274 pseudobonds
> show (#!1 & sel) target ab
> undo
Drag select of 1 residues
> undo
Drag select of 306 residues, 296 pseudobonds
> select subtract /A:2139
5605 atoms, 357 pseudobonds, 348 residues, 2 models selected
> select subtract /A:2097
5589 atoms, 357 pseudobonds, 347 residues, 2 models selected
> undo
Drag select of 35 residues, 114 pseudobonds
Drag select of 50 residues, 111 pseudobonds
Drag select of 31 residues, 11 pseudobonds
> select add /A:1651
2570 atoms, 6 bonds, 283 pseudobonds, 160 residues, 2 models selected
> select add /A:787
2587 atoms, 23 bonds, 283 pseudobonds, 161 residues, 2 models selected
> select add /A:1652
2604 atoms, 39 bonds, 283 pseudobonds, 162 residues, 2 models selected
> select add /A:1643
2624 atoms, 59 bonds, 283 pseudobonds, 163 residues, 2 models selected
> select add /A:1644
2640 atoms, 74 bonds, 284 pseudobonds, 164 residues, 2 models selected
> show (#!1 & sel) target ab
> label (#!1 & sel) text "/{0.chain_id} {0.label_one_letter_code}
> {0.number}{0.insertion_code}"
> view sel
> save "/Users/carloscordova/Downloads/prediction_SPAG17_PRM1 and
> PRM2/SPAG17_prm1_2_5.cxs"
> view /C:1
> select /A
35362 atoms, 35734 bonds, 2223 residues, 1 model selected
> style sel sphere
Changed 35362 atom styles
> undo
> style sel ball
Changed 35362 atom styles
> undo
> rainbow sel
> undo
> color bfactor sel
2640 atoms, 164 residues, atom bfactor range 12.6 to 95.4
> undo
> color sel bypolymer
> undo
> mlp sel
Map values for surface "selected_prediction.pdb_A SES surface": minimum
-28.57, mean -3.834, maximum 26.88
Map values for surface "selected_prediction.pdb_C SES surface": minimum
-22.74, mean -4.66, maximum 22.28
To also show corresponding color key, enter the above mlp command and add key
true
> undo
> close session
> ui tool show AlphaFold
> alphafold predict
> MAPKKEKPTGSANYKIWEPSLIAAHLNQNDWKASIAFVVGNRVEDDLLIHALDLAVRLPQRKLFSIVSWEDILQQMDEIQSLAESASAKKGKKPTSVNLPLHYEVFLAAKIIMESGEKLTLPLIGKLLKCQLLHIKSKDQQRRENEKKMVEERTKSEKDKGKGKSPKEKKVASAKPGKGKSKDQPEATVTVRKTTQLKRRGEDDEAKSYIDDEPDDGAQYYIIVVGFNNPQLLAIMTELGIPITSVIKISSENYEPLQTHLAAVRQQQEAVLQPEDIEAEKLKRKNSIKELEVFWKYLEPILNNEKLEIHLFDVARLQYMVKATYFPSDWSDNEQMLALGTEIFENIACLMYDSLDWKRQHHHYLQSMQLINVPQVVSEKTVLEAITIPEPPPSTAPAPTGKKKAQYEESHAPPTVAFIITTEVDMRYYNDLLNPIPEEFISVSLILHCMVEQVVATEEDLIPPSLVEPAPRADGLDYRIAAHIVSILPSLCLSEKEKKNLREIFLTEGESESKALPKGPLLLNYHDAHAHKKYALKDQKNFDPVQVEQEMQSKLPLWEFLQFPLPPPWNSTKRLATIHELMHFCTNEVLSWNEVERAFKVFTFESLKLSEVDEEGRLKPTETTSDTDVENFNIPWDNPARFAKLIRQRYIHRMSMQKAPPVVVEIENTERTLFVNKNFAKAEQDAQGDENSPNSDEPDAISVTGSTSNSTKPWNSSNRQFSEKETSGSMWPQPESMDQTMDTEIKDDAATKDDSPEKKPKKMVVEADIEDIKKTQQRSLMDWSFTEYFQPKVLLQVLQEAHQQYRCVDSYYHTQDNSLLLVFHNPMNLQRLQCEHWNIALHSNVGFRNYLELVAKSIEDWVTQEEAKYQEAKMAEELNRIRIELELKATVKTSASKIPGPKRSKTNKVSSKTELSDQEKDKEKEKDKIPFVLEGSLKAWKEEQERLAEEERLKEEKKAEKKGKDTGKKKGKDKADKDDAKALKKKSSSKEKPKEEPAKTLEVIEETAPLPVPEVVYPFRGYNMGDIPIQISGTNYYLYPSDGGQIEVEKTRFERGSTFIKVKVKKDKHNFIIHLKDPKEIVKKEKEEKNSEEEEEEEEEKEEVEEKKPKEGEEEKVKQKVEMKRAQIEKEAVSKFGSFSATLENGICLSISYYGSNGMAPEVINSELEAMMNIPSAMTATVVPAVVTVPQGKGKAKPKGKEKHKDSIKEEELPKEEEKKNHIQEEVEPEIVIQESPPYVPTFQNLNVSCPSGLLLTFIGQESTDYSIVDEEPTRNLMIRQSYPQRLKHYEFYKAVMPPLEQEASRVVTSQGTVIKYMLDGSTQILFADGAVSSSPDSGPVYTSPELPTSPHNGDLVDSASQPKSETGPEIIITKKGKGHKNQTVANKSETHDIIPEVPPPTPVESHIGTWFTTTPDGRRIGTKGLEKIEDLKPYLFFQATDPINGTVMTTREDKVIIVEKKDGTRVVDHADGTRITTFYQVYEDHITPSNDEETTEGPRTVTRQVKCMRIESSHYATIITNCEDSSCCATFGDGTSIIAKPQGSYQVLPPNTGCLYIDKDCSATYCHESSNNLYHPFQKREQLRASRYIMKHTSEVICEVQDPEGNTFQVMADGSVSTTLPKKKLEDDFNVQMEGYESLSSLHLEKNHMQIYGEHVPRFFVVYTDGSGVELLRDSDIEEYLSLAYGESTTVVLQEPVQEYPGALSITVLRPFHEASQWIMKKELDTIVPPNLQSRSWERFPSVEKKTPGPPFGTQIWKGLSIGSKQLTNIPAPILEGPKVLQMRQFIQHEVIKNEVKLKLQISLKDYINHILKKEDELQEMTVKDSRTEEERGNAADLLKLVMSFPKMEETTKSHMTKVAAHLTVLFKQSMASAPKCSPDSYSKEFLEKKWRSLSQGTSWKEKLEQQRNNIKKTQSYLMQIKTKEVTPYFKSELSSLFKSKYDYLEKFSKSLPPFVKKNEAKLMTAVPDLYSDSTLTVDTEKEASNTHPLLNQEVAENIQESPREKETEYVNKSLQTSSSQNQYENVTISPKESVYQSQTEIETKDTKESAIQNFTEKFKKYTKKSASQNEIEDLIKSTKESVSQRQTENVTRPPTEEPDIYMPIKIPTQSLLQDVTGQARKEKVRLPYYMMSSKPKSQPYAKVEDPVGGRVNTSSIASAAMYNPNASPFGFHLLPPSVKFGVLKEGHTYATIVKLKNVGVDFCRFRVKQPPPSTGLKVTYKPGPVAAGLQAELKVELFAMAVGEDGAKGSAHISHNIEIMTEHDVLFLPVEATVLTSSNYDNRPKNLPQGKENPMVFRTSTISSSSLGVVMSQKATHH,MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPQEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDQAETIANLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPESVQGGTFGFNSSTNVPTEGFQF
Please cite ColabFold: Making protein folding accessible to all. Nature
Methods (2022) if you use these predictions.
Running AlphaFold prediction
===== Log before crash end =====
Log:
Startup Messages
---
note | available bundle cache has not been initialized yet
UCSF ChimeraX version: 1.8 (2024-06-10)
© 2016-2024 Regents of the University of California. All rights reserved.
How to cite UCSF ChimeraX
OpenGL version: 4.1 INTEL-16.5.14
OpenGL renderer: Intel Iris OpenGL Engine
OpenGL vendor: Intel Inc.
Python: 3.11.4
Locale: UTF-8
Qt version: PyQt6 6.6.1, Qt 6.6.1
Qt runtime version: 6.6.3
Qt platform: cocoa
Hardware:
Hardware Overview:
Model Name: MacBook Pro
Model Identifier: MacBookPro11,1
Processor Name: Dual-Core Intel Core i5
Processor Speed: 2.8 GHz
Number of Processors: 1
Total Number of Cores: 2
L2 Cache (per Core): 256 KB
L3 Cache: 3 MB
Hyper-Threading Technology: Enabled
Memory: 8 GB
System Firmware Version: 478.0.0.0.0
SMC Version (system): 2.16f68
Software:
System Software Overview:
System Version: macOS 11.7.10 (20G1427)
Kernel Version: Darwin 20.6.0
Time since boot: 5 minutes
Graphics/Displays:
Intel Iris:
Chipset Model: Intel Iris
Type: GPU
Bus: Built-In
VRAM (Dynamic, Max): 1536 MB
Vendor: Intel
Device ID: 0x0a2e
Revision ID: 0x0009
Metal Family: Supported, Metal GPUFamily macOS 1
Displays:
Color LCD:
Display Type: Built-In Retina LCD
Resolution: 2560 x 1600 Retina
Framebuffer Depth: 24-Bit Color (ARGB8888)
Main Display: Yes
Mirror: Off
Online: Yes
Automatically Adjust Brightness: Yes
Connection Type: Internal
Installed Packages:
alabaster: 0.7.16
appdirs: 1.4.4
appnope: 0.1.4
asttokens: 2.4.1
Babel: 2.15.0
beautifulsoup4: 4.12.3
blockdiag: 3.0.0
blosc2: 2.0.0
build: 1.2.1
certifi: 2023.11.17
cftime: 1.6.4
charset-normalizer: 3.3.2
ChimeraX-AddCharge: 1.5.17
ChimeraX-AddH: 2.2.6
ChimeraX-AlignmentAlgorithms: 2.0.2
ChimeraX-AlignmentHdrs: 3.5
ChimeraX-AlignmentMatrices: 2.1
ChimeraX-Alignments: 2.12.7
ChimeraX-AlphaFold: 1.0
ChimeraX-AltlocExplorer: 1.1.1
ChimeraX-AmberInfo: 1.0
ChimeraX-Arrays: 1.1
ChimeraX-Atomic: 1.57.1
ChimeraX-AtomicLibrary: 14.0.6
ChimeraX-AtomSearch: 2.0.1
ChimeraX-AxesPlanes: 2.4
ChimeraX-BasicActions: 1.1.2
ChimeraX-BILD: 1.0
ChimeraX-BlastProtein: 2.4.6
ChimeraX-BondRot: 2.0.4
ChimeraX-BugReporter: 1.0.1
ChimeraX-BuildStructure: 2.12.1
ChimeraX-Bumps: 1.0
ChimeraX-BundleBuilder: 1.2.7
ChimeraX-ButtonPanel: 1.0.1
ChimeraX-CageBuilder: 1.0.1
ChimeraX-CellPack: 1.0
ChimeraX-Centroids: 1.4
ChimeraX-ChangeChains: 1.1
ChimeraX-CheckWaters: 1.4
ChimeraX-ChemGroup: 2.0.1
ChimeraX-Clashes: 2.2.4
ChimeraX-ColorActions: 1.0.5
ChimeraX-ColorGlobe: 1.0
ChimeraX-ColorKey: 1.5.6
ChimeraX-CommandLine: 1.2.5
ChimeraX-ConnectStructure: 2.0.1
ChimeraX-Contacts: 1.0.1
ChimeraX-Core: 1.8
ChimeraX-CoreFormats: 1.2
ChimeraX-coulombic: 1.4.3
ChimeraX-Crosslinks: 1.0
ChimeraX-Crystal: 1.0
ChimeraX-CrystalContacts: 1.0.1
ChimeraX-DataFormats: 1.2.3
ChimeraX-Dicom: 1.2.4
ChimeraX-DiffPlot: 1.0
ChimeraX-DistMonitor: 1.4.2
ChimeraX-DockPrep: 1.1.3
ChimeraX-Dssp: 2.0
ChimeraX-EMDB-SFF: 1.0
ChimeraX-ESMFold: 1.0
ChimeraX-FileHistory: 1.0.1
ChimeraX-FunctionKey: 1.0.1
ChimeraX-Geometry: 1.3
ChimeraX-gltf: 1.0
ChimeraX-Graphics: 1.1.1
ChimeraX-Hbonds: 2.4
ChimeraX-Help: 1.2.2
ChimeraX-HKCage: 1.3
ChimeraX-IHM: 1.1
ChimeraX-ImageFormats: 1.2
ChimeraX-IMOD: 1.0
ChimeraX-IO: 1.0.1
ChimeraX-ItemsInspection: 1.0.1
ChimeraX-IUPAC: 1.0
ChimeraX-Label: 1.1.10
ChimeraX-ListInfo: 1.2.2
ChimeraX-Log: 1.1.6
ChimeraX-LookingGlass: 1.1
ChimeraX-Maestro: 1.9.1
ChimeraX-Map: 1.2
ChimeraX-MapData: 2.0
ChimeraX-MapEraser: 1.0.1
ChimeraX-MapFilter: 2.0.1
ChimeraX-MapFit: 2.0
ChimeraX-MapSeries: 2.1.1
ChimeraX-Markers: 1.0.1
ChimeraX-Mask: 1.0.2
ChimeraX-MatchMaker: 2.1.3
ChimeraX-MCopy: 1.0
ChimeraX-MDcrds: 2.7.1
ChimeraX-MedicalToolbar: 1.0.3
ChimeraX-Meeting: 1.0.1
ChimeraX-MLP: 1.1.1
ChimeraX-mmCIF: 2.14.1
ChimeraX-MMTF: 2.2
ChimeraX-Modeller: 1.5.17
ChimeraX-ModelPanel: 1.5
ChimeraX-ModelSeries: 1.0.1
ChimeraX-Mol2: 2.0.3
ChimeraX-Mole: 1.0
ChimeraX-Morph: 1.0.2
ChimeraX-MouseModes: 1.2
ChimeraX-Movie: 1.0
ChimeraX-Neuron: 1.0
ChimeraX-Nifti: 1.2
ChimeraX-NMRSTAR: 1.0.2
ChimeraX-NRRD: 1.2
ChimeraX-Nucleotides: 2.0.3
ChimeraX-OpenCommand: 1.13.5
ChimeraX-PDB: 2.7.5
ChimeraX-PDBBio: 1.0.1
ChimeraX-PDBLibrary: 1.0.4
ChimeraX-PDBMatrices: 1.0
ChimeraX-PickBlobs: 1.0.1
ChimeraX-Positions: 1.0
ChimeraX-PresetMgr: 1.1.1
ChimeraX-PubChem: 2.2
ChimeraX-ReadPbonds: 1.0.1
ChimeraX-Registration: 1.1.2
ChimeraX-RemoteControl: 1.0
ChimeraX-RenderByAttr: 1.4.1
ChimeraX-RenumberResidues: 1.1
ChimeraX-ResidueFit: 1.0.1
ChimeraX-RestServer: 1.2
ChimeraX-RNALayout: 1.0
ChimeraX-RotamerLibMgr: 4.0
ChimeraX-RotamerLibsDunbrack: 2.0
ChimeraX-RotamerLibsDynameomics: 2.0
ChimeraX-RotamerLibsRichardson: 2.0
ChimeraX-SaveCommand: 1.5.1
ChimeraX-SchemeMgr: 1.0
ChimeraX-SDF: 2.0.2
ChimeraX-Segger: 1.0
ChimeraX-Segment: 1.0.1
ChimeraX-Segmentations: 3.0.15
ChimeraX-SelInspector: 1.0
ChimeraX-SeqView: 2.11.2
ChimeraX-Shape: 1.0.1
ChimeraX-Shell: 1.0.1
ChimeraX-Shortcuts: 1.1.1
ChimeraX-ShowSequences: 1.0.3
ChimeraX-SideView: 1.0.1
ChimeraX-Smiles: 2.1.2
ChimeraX-SmoothLines: 1.0
ChimeraX-SpaceNavigator: 1.0
ChimeraX-StdCommands: 1.16.5
ChimeraX-STL: 1.0.1
ChimeraX-Storm: 1.0
ChimeraX-StructMeasure: 1.2.1
ChimeraX-Struts: 1.0.1
ChimeraX-Surface: 1.0.1
ChimeraX-SwapAA: 2.0.1
ChimeraX-SwapRes: 2.5
ChimeraX-TapeMeasure: 1.0
ChimeraX-TaskManager: 1.0
ChimeraX-Test: 1.0
ChimeraX-Toolbar: 1.1.2
ChimeraX-ToolshedUtils: 1.2.4
ChimeraX-Topography: 1.0
ChimeraX-ToQuest: 1.0
ChimeraX-Tug: 1.0.1
ChimeraX-UI: 1.39.1
ChimeraX-uniprot: 2.3
ChimeraX-UnitCell: 1.0.1
ChimeraX-ViewDockX: 1.4.3
ChimeraX-VIPERdb: 1.0
ChimeraX-Vive: 1.1
ChimeraX-VolumeMenu: 1.0.1
ChimeraX-vrml: 1.0
ChimeraX-VTK: 1.0
ChimeraX-WavefrontOBJ: 1.0
ChimeraX-WebCam: 1.0.2
ChimeraX-WebServices: 1.1.4
ChimeraX-Zone: 1.0.1
colorama: 0.4.6
comm: 0.2.2
contourpy: 1.2.1
cxservices: 1.2.2
cycler: 0.12.1
Cython: 3.0.10
debugpy: 1.8.1
decorator: 5.1.1
docutils: 0.20.1
executing: 2.0.1
filelock: 3.13.4
fonttools: 4.53.0
funcparserlib: 2.0.0a0
glfw: 2.7.0
grako: 3.16.5
h5py: 3.11.0
html2text: 2024.2.26
idna: 3.7
ihm: 1.0
imagecodecs: 2024.1.1
imagesize: 1.4.1
ipykernel: 6.29.2
ipython: 8.21.0
ipywidgets: 8.1.3
jedi: 0.19.1
jinja2: 3.1.4
jupyter-client: 8.6.0
jupyter-core: 5.7.2
jupyterlab-widgets: 3.0.11
kiwisolver: 1.4.5
line-profiler: 4.1.2
lxml: 5.2.1
lz4: 4.3.3
MarkupSafe: 2.1.5
matplotlib: 3.8.4
matplotlib-inline: 0.1.7
msgpack: 1.0.8
nest-asyncio: 1.6.0
netCDF4: 1.6.5
networkx: 3.3
nibabel: 5.2.0
nptyping: 2.5.0
numexpr: 2.10.0
numpy: 1.26.4
openvr: 1.26.701
packaging: 23.2
ParmEd: 4.2.2
parso: 0.8.4
pep517: 0.13.1
pexpect: 4.9.0
pillow: 10.3.0
pip: 24.0
pkginfo: 1.10.0
platformdirs: 4.2.2
prompt-toolkit: 3.0.47
psutil: 5.9.8
ptyprocess: 0.7.0
pure-eval: 0.2.2
py-cpuinfo: 9.0.0
pycollada: 0.8
pydicom: 2.4.4
pygments: 2.17.2
pynmrstar: 3.3.4
pynrrd: 1.0.0
PyOpenGL: 3.1.7
PyOpenGL-accelerate: 3.1.7
pyopenxr: 1.0.3401
pyparsing: 3.1.2
pyproject-hooks: 1.1.0
PyQt6-commercial: 6.6.1
PyQt6-Qt6: 6.6.3
PyQt6-sip: 13.6.0
PyQt6-WebEngine-commercial: 6.6.0
PyQt6-WebEngine-Qt6: 6.6.3
python-dateutil: 2.9.0.post0
pytz: 2024.1
pyzmq: 26.0.3
qtconsole: 5.5.1
QtPy: 2.4.1
RandomWords: 0.4.0
requests: 2.31.0
scipy: 1.13.0
setuptools: 69.5.1
setuptools-scm: 8.0.4
sfftk-rw: 0.8.1
six: 1.16.0
snowballstemmer: 2.2.0
sortedcontainers: 2.4.0
soupsieve: 2.5
sphinx: 7.2.6
sphinx-autodoc-typehints: 2.0.1
sphinxcontrib-applehelp: 1.0.8
sphinxcontrib-blockdiag: 3.0.0
sphinxcontrib-devhelp: 1.0.6
sphinxcontrib-htmlhelp: 2.0.5
sphinxcontrib-jsmath: 1.0.1
sphinxcontrib-qthelp: 1.0.7
sphinxcontrib-serializinghtml: 1.1.10
stack-data: 0.6.3
superqt: 0.6.3
tables: 3.8.0
tcia-utils: 1.5.1
tifffile: 2024.1.30
tinyarray: 1.2.4
tornado: 6.4.1
traitlets: 5.14.2
typing-extensions: 4.12.2
tzdata: 2024.1
urllib3: 2.2.1
wcwidth: 0.2.13
webcolors: 1.13
wheel: 0.43.0
wheel-filename: 1.4.1
widgetsnbextension: 4.0.11
Change History (2)
comment:1 by , 23 months ago
| Component: | Unassigned → Structure Prediction |
|---|---|
| Owner: | set to |
| Platform: | → all |
| Project: | → ChimeraX |
| Status: | new → assigned |
| Summary: | ChimeraX bug report submission → Crash running AlphaFold prediction |
comment:2 by , 23 months ago
| Resolution: | → can't reproduce |
|---|---|
| Status: | assigned → closed |
| Summary: | Crash running AlphaFold prediction → Crash no Python or C stack traces, after running AlphaFold prediction |
Note:
See TracTickets
for help on using tickets.