OSError in python_instances_of_class

[chimerax-bug-report@…]

The following bug report has been submitted:
Platform:        Windows-10-10.0.22631
ChimeraX Version: 1.8.dev202403200605 (2024-03-20 06:05:36 UTC)
Description
(Describe the actions that caused this problem to occur here)

Log:
UCSF ChimeraX version: 1.8.dev202403200605 (2024-03-20)  
© 2016-2024 Regents of the University of California. All rights reserved.  

> open "C:\Users\hanbi\Box\Cav1 supergroup folder\manuscripts in
> progress\1st_paper_phylo_AF2_CryoEM\Figures\v1\domin_comparison\domains_comp_240513.cxs"
> format session

Log from Mon May 13 21:16:42 2024UCSF ChimeraX version: 1.8.dev202403200605
(2024-03-20)  
© 2016-2024 Regents of the University of California. All rights reserved.  
How to cite UCSF ChimeraX  

> ui tool show AlphaFold

> alphafold predict
> HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_10mer

Please cite ColabFold: Making protein folding accessible to all. Nature
Methods (2022) if you use these predictions.  
Running AlphaFold prediction  

> alphafold predict
> HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_10mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_10mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_10mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D E F G H I J | No description available  
  

> close

> alphafold predict
> NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/q93yn8_169_296_10mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/q93yn8_169_296_10mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/q93yn8_169_296_10mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D E F G H I J | No description available  
  

> show cartoons

> hide atoms

Compositor returned null texture  
[Repeated 1 time(s)]

> alphafold predict
> NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS,NRMVTTASVQRVKREEVEAKITAWQTAKVAKINNRFKRQDAVINGWLNEQVHRANSWMKKIERKLEDRRAKAMEKTQNKVAKAQRKAEERRATAEGKRGTEVARVLEVANLMRAVGRPPAKRSFFSLS
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/q93yn8_169_296_10mer

Running AlphaFold prediction  

> show surfaces

> coulombic

Using Amber 20 recommended default charges and atom types for standard
residues  
Coulombic values for best_model.pdb_A SES surface #1.1: minimum, -8.88, mean
3.11, maximum 17.67  
Coulombic values for best_model.pdb_B SES surface #1.2: minimum, -9.19, mean
3.09, maximum 17.37  
Coulombic values for best_model.pdb_C SES surface #1.3: minimum, -9.21, mean
3.09, maximum 17.41  
Coulombic values for best_model.pdb_D SES surface #1.4: minimum, -8.98, mean
3.12, maximum 17.96  
Coulombic values for best_model.pdb_E SES surface #1.5: minimum, -8.83, mean
3.12, maximum 17.80  
Coulombic values for best_model.pdb_F SES surface #1.6: minimum, -9.13, mean
3.14, maximum 17.68  
Coulombic values for best_model.pdb_G SES surface #1.7: minimum, -9.10, mean
3.09, maximum 16.84  
Coulombic values for best_model.pdb_H SES surface #1.8: minimum, -8.94, mean
3.09, maximum 19.92  
Coulombic values for best_model.pdb_I SES surface #1.9: minimum, -9.78, mean
3.08, maximum 16.87  
Coulombic values for best_model.pdb_J SES surface #1.10: minimum, -8.88, mean
3.13, maximum 19.65  
To also show corresponding color key, enter the above coulombic command and
add key true  

> mlp

Map values for surface "best_model.pdb_A SES surface": minimum -25.33, mean
-3.217, maximum 22.54  
Map values for surface "best_model.pdb_B SES surface": minimum -23.8, mean
-3.168, maximum 22.68  
Map values for surface "best_model.pdb_C SES surface": minimum -23.8, mean
-3.144, maximum 22.32  
Map values for surface "best_model.pdb_D SES surface": minimum -24.06, mean
-3.197, maximum 21.87  
Map values for surface "best_model.pdb_E SES surface": minimum -24.55, mean
-3.227, maximum 23.54  
Map values for surface "best_model.pdb_F SES surface": minimum -24.99, mean
-3.172, maximum 22.06  
Map values for surface "best_model.pdb_G SES surface": minimum -24.81, mean
-3.21, maximum 22.11  
Map values for surface "best_model.pdb_H SES surface": minimum -25.49, mean
-3.152, maximum 22.51  
Map values for surface "best_model.pdb_I SES surface": minimum -25.74, mean
-3.143, maximum 22.36  
Map values for surface "best_model.pdb_J SES surface": minimum -24.58, mean
-3.184, maximum 22.01  
To also show corresponding color key, enter the above mlp command and add key
true  

> coulombic

Coulombic values for best_model.pdb_A SES surface #1.1: minimum, -8.88, mean
3.11, maximum 17.67  
Coulombic values for best_model.pdb_B SES surface #1.2: minimum, -9.19, mean
3.09, maximum 17.37  
Coulombic values for best_model.pdb_C SES surface #1.3: minimum, -9.21, mean
3.09, maximum 17.41  
Coulombic values for best_model.pdb_D SES surface #1.4: minimum, -8.98, mean
3.12, maximum 17.96  
Coulombic values for best_model.pdb_E SES surface #1.5: minimum, -8.83, mean
3.12, maximum 17.80  
Coulombic values for best_model.pdb_F SES surface #1.6: minimum, -9.13, mean
3.14, maximum 17.68  
Coulombic values for best_model.pdb_G SES surface #1.7: minimum, -9.10, mean
3.09, maximum 16.84  
Coulombic values for best_model.pdb_H SES surface #1.8: minimum, -8.94, mean
3.09, maximum 19.92  
Coulombic values for best_model.pdb_I SES surface #1.9: minimum, -9.78, mean
3.08, maximum 16.87  
Coulombic values for best_model.pdb_J SES surface #1.10: minimum, -8.88, mean
3.13, maximum 19.65  
To also show corresponding color key, enter the above coulombic command and
add key true  
Compositor returned null texture  
[Repeated 2 time(s)]

> close

AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/q93yn8_169_296_10mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/q93yn8_169_296_10mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D E F G H I J | No description available  
  

> close

> open
> C:/Users/hanbi/Downloads/ChimeraX/AlphaFold/q93yn8_169_296_16mer/af2048_unrelaxed_rank_001_alphafold2_multimer_v3_model_4_seed_000.pdb

Chain information for
af2048_unrelaxed_rank_001_alphafold2_multimer_v3_model_4_seed_000.pdb #1  
---  
Chain | Description  
A B C D E F G H I J K L M N O P | No description available  
  

> show cartoons

> hide atoms

> close

> alphafold predict
> HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_16mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_16mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_16mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D E F G H I J K L M N O P | No description available  
  

> close

> alphafold predict
> MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF,MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF,MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF,MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF,MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF,MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF,MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF,MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF,MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF,MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF,MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF,MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A087WYI9_12mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A087WYI9_12mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A087WYI9_12mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D E F G H I J K L | No description available  
  

> close

> alphafold predict
> MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF,MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A087WYI9_2mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A087WYI9_2mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A087WYI9_2mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B | No description available  
  

> close

> alphafold predict
> MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF,MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF,MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRESKRRENGRKGPAVRLTGHQRQREEDQLGRVLVSGIRLRF
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A087WYI9_3mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A087WYI9_3mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A087WYI9_3mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C | No description available  
  

> close

> alphafold predict
> HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_2mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_2mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_2mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B | No description available  
  

> close

> alphafold predict
> HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_3mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_3mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_3mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C | No description available  
  

> close

> alphafold predict
> HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_4mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_4mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_4mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D | No description available  
  

> close

> alphafold predict
> HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH,HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASH
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_4mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_4mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/P21127_121_230_4mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D | No description available  
  

> close

> alphafold predict
> MRSRVESEDNARRLKLLHEAKRKAVGWLQELKQASKRSSKAKNKLASQEDATPSSSASGGCAAPVETEKPPVQHTVLPTIIITAVSTPTEPCPSINTCSKLLTLCEQRE,MRSRVESEDNARRLKLLHEAKRKAVGWLQELKQASKRSSKAKNKLASQEDATPSSSASGGCAAPVETEKPPVQHTVLPTIIITAVSTPTEPCPSINTCSKLLTLCEQRE
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A0N4V8F6_2mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A0N4V8F6_2mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A0N4V8F6_2mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B | No description available  
  

> close

> alphafold predict
> MRSRVESEDNARRLKLLHEAKRKAVGWLQELKQASKRSSKAKNKLASQEDATPSSSASGGCAAPVETEKPPVQHTVLPTIIITAVSTPTEPCPSINTCSKLLTLCEQRE,MRSRVESEDNARRLKLLHEAKRKAVGWLQELKQASKRSSKAKNKLASQEDATPSSSASGGCAAPVETEKPPVQHTVLPTIIITAVSTPTEPCPSINTCSKLLTLCEQRE,MRSRVESEDNARRLKLLHEAKRKAVGWLQELKQASKRSSKAKNKLASQEDATPSSSASGGCAAPVETEKPPVQHTVLPTIIITAVSTPTEPCPSINTCSKLLTLCEQRE,MRSRVESEDNARRLKLLHEAKRKAVGWLQELKQASKRSSKAKNKLASQEDATPSSSASGGCAAPVETEKPPVQHTVLPTIIITAVSTPTEPCPSINTCSKLLTLCEQRE
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A0N4V8F6_4mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A0N4V8F6_4mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A0N4V8F6_4mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D | No description available  
  

> close

> alphafold predict
> MRSRVESEDNARRLKLLHEAKRKAVGWLQELKQASKRSSKAKNKLASQEDATPSSSASGGCAAPVETEKPPVQHTVLPTIIITAVSTPTEPCPSINTCSKLLTLCEQRE,MRSRVESEDNARRLKLLHEAKRKAVGWLQELKQASKRSSKAKNKLASQEDATPSSSASGGCAAPVETEKPPVQHTVLPTIIITAVSTPTEPCPSINTCSKLLTLCEQRE,MRSRVESEDNARRLKLLHEAKRKAVGWLQELKQASKRSSKAKNKLASQEDATPSSSASGGCAAPVETEKPPVQHTVLPTIIITAVSTPTEPCPSINTCSKLLTLCEQRE,MRSRVESEDNARRLKLLHEAKRKAVGWLQELKQASKRSSKAKNKLASQEDATPSSSASGGCAAPVETEKPPVQHTVLPTIIITAVSTPTEPCPSINTCSKLLTLCEQRE,MRSRVESEDNARRLKLLHEAKRKAVGWLQELKQASKRSSKAKNKLASQEDATPSSSASGGCAAPVETEKPPVQHTVLPTIIITAVSTPTEPCPSINTCSKLLTLCEQRE,MRSRVESEDNARRLKLLHEAKRKAVGWLQELKQASKRSSKAKNKLASQEDATPSSSASGGCAAPVETEKPPVQHTVLPTIIITAVSTPTEPCPSINTCSKLLTLCEQRE,MRSRVESEDNARRLKLLHEAKRKAVGWLQELKQASKRSSKAKNKLASQEDATPSSSASGGCAAPVETEKPPVQHTVLPTIIITAVSTPTEPCPSINTCSKLLTLCEQRE,MRSRVESEDNARRLKLLHEAKRKAVGWLQELKQASKRSSKAKNKLASQEDATPSSSASGGCAAPVETEKPPVQHTVLPTIIITAVSTPTEPCPSINTCSKLLTLCEQRE
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A0N4V8F6_8mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A0N4V8F6_8mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A0A0N4V8F6_8mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D E F G H | No description available  
  

> show cartoons

> hide atoms

> close

> alphafold predict
> MGLLDPSNPSLAQFFSPAKVQSICKQMTAVEATKRDEQACKKDAKLQYTILKKQKEADIMSQWMKWKGAHQAAKEQKEMDKAARAAQQQIEKELRDARNV,MGLLDPSNPSLAQFFSPAKVQSICKQMTAVEATKRDEQACKKDAKLQYTILKKQKEADIMSQWMKWKGAHQAAKEQKEMDKAARAAQQQIEKELRDARNV
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A6RFS9_2mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A6RFS9_2mer  

> open C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A6RFS9_2mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B | No description available  
  

> close

> alphafold predict
> MGLLDPSNPSLAQFFSPAKVQSICKQMTAVEATKRDEQACKKDAKLQYTILKKQKEADIMSQWMKWKGAHQAAKEQKEMDKAARAAQQQIEKELRDARNV,MGLLDPSNPSLAQFFSPAKVQSICKQMTAVEATKRDEQACKKDAKLQYTILKKQKEADIMSQWMKWKGAHQAAKEQKEMDKAARAAQQQIEKELRDARNV,MGLLDPSNPSLAQFFSPAKVQSICKQMTAVEATKRDEQACKKDAKLQYTILKKQKEADIMSQWMKWKGAHQAAKEQKEMDKAARAAQQQIEKELRDARNV,MGLLDPSNPSLAQFFSPAKVQSICKQMTAVEATKRDEQACKKDAKLQYTILKKQKEADIMSQWMKWKGAHQAAKEQKEMDKAARAAQQQIEKELRDARNV
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A6RFS9_4mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A6RFS9_4mer  

> open C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/A6RFS9_4mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D | No description available  
  
Compositor returned null texture  

> close

> alphafold predict
> PPTKQEVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQERRRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAG,PPTKQEVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQERRRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAG
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/Q3KQU3_126_235_2mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/Q3KQU3_126_235_2mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/Q3KQU3_126_235_2mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B | No description available  
  
Compositor returned null texture  

> close

> alphafold predict
> PPTKQEVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQERRRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAG,PPTKQEVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQERRRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAG,PPTKQEVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQERRRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAG,PPTKQEVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQERRRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAG
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/Q3KQU3_126_235_4mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/Q3KQU3_126_235_4mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/Q3KQU3_126_235_4mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D | No description available  
  
Compositor returned null texture  
[Repeated 1 time(s)]

> close

> alphafold predict
> PPTKQEVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQERRRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAG,PPTKQEVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQERRRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAG,PPTKQEVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQERRRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAG,PPTKQEVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQERRRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAG,PPTKQEVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQERRRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAG,PPTKQEVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQERRRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAG,PPTKQEVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQERRRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAG,PPTKQEVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQERRRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAG
> directory C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/Q3KQU3_126_235_8mer

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/Q3KQU3_126_235_8mer  

> open
> C:\Users\hanbi/Downloads/ChimeraX/AlphaFold/Q3KQU3_126_235_8mer\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D E F G H | No description available  
  

> close

> open "C:/Users/hanbi/Box/Bing, Randall, and
> Anne/AF2models_2.2/Q03135/Human_CAV1_11mer/best_model.pdb"

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D E F G H I J K | No description available  
  

> close

> open "C:/Users/hanbi/Box/Bing, Randall, and
> Anne/AF2models_2.2/Q03135/Human_CAV1_11mer/best_model.pdb"

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D E F G H I J K | No description available  
  

> open "C:/Users/hanbi/Box/Bing, Randall, and
> Anne/AF2models_2.2/Q03135/Human_CAV1_11mer/best_model.pdb"

Chain information for best_model.pdb #2  
---  
Chain | Description  
A B C D E F G H I J K | No description available  
  

> show cartoons

> hide atoms

> set bgColor white

> set bgColor #ffffff00

> lighting flat

> color light gray

> color white

> lighting full

> lighting flat

> select #1:49-60

1100 atoms, 1111 bonds, 132 residues, 1 model selected  

> color sel yellow

> lighting full

> lighting simple

> lighting soft

> lighting simple

> select #1:61-101

3806 atoms, 3938 bonds, 451 residues, 1 model selected  

> color sel cornflower blue

> lighting flat

> lighting full

> lighting flat

> lighting soft

> lighting simple

> lighting flat

> graphics silhouettes false

> lighting flat

> lighting soft

> lighting flat

> lighting simple

> lighting flat

> color sel blue

> select #1:68-75

704 atoms, 715 bonds, 88 residues, 1 model selected  

> color sel red

> select #1:82-101

1980 atoms, 2068 bonds, 220 residues, 1 model selected  

> color sel forest green

> select #1:102-134

2871 atoms, 2981 bonds, 363 residues, 1 model selected  

> color sel purple

> select #1:135-169

3102 atoms, 3168 bonds, 385 residues, 1 model selected  

> color sel gray

> select #1:170-176

660 atoms, 649 bonds, 77 residues, 1 model selected  

> color sel cyan

> color #1:170-176 red target c

> color #1:170-176 cyan target c

> color #1:170-176 cyan :135-169 gray target c

Expected a collection of one of 'All', 'atoms', 'bonds', 'cartoons', 'labels',
'models', 'pseudobonds', 'ribbons', 'rings', or 'surfaces' or a keyword  

> color #1:170-176 cyan #1:135-169 gray target c

Expected a collection of one of 'All', 'atoms', 'bonds', 'cartoons', 'labels',
'models', 'pseudobonds', 'ribbons', 'rings', or 'surfaces' or a keyword  

> color #1:170-176 cyan target c #1:135-169 gray target c

Expected a keyword  

> color #1:170-176 cyan target color c #1:135-169 gray target c

Invalid "target" argument: Character 'o' is not an allowed target, must be one
of acrsbmpfl  

> color #1:170-176 cyan target; color c #1:135-169 gray target c

Invalid "target" argument: Character ';' is not an allowed target, must be one
of acrsbmpfl  

> ui windowfill toggle

[Repeated 1 time(s)]

> color #1:170-176 cyan targetcolor c #1:135-169 gray target c

Expected a collection of one of 'All', 'atoms', 'bonds', 'cartoons', 'labels',
'models', 'pseudobonds', 'ribbons', 'rings', or 'surfaces' or a keyword  

> open C:/Users/hanbi/Figures/v6/domin_comparison/domins.cxc

> color #1:170-176 cyan target c

> color cylindrical #1:135-169 gray target c

Expected a keyword  

> open C:/Users/hanbi/Figures/v6/domin_comparison/domins.cxc

> color #1:170-176 cyan target c

> color #1:135-169 gray target c

executed domins.cxc  

> open C:/Users/hanbi/Figures/v6/domin_comparison/domins.cxc

> color #1:170-176 red target c

> color #1:135-169 gray target c

executed domins.cxc  

> open C:/Users/hanbi/Figures/v6/domin_comparison/domins.cxc

> color #1:170-176 cyan target c

> color #1:135-169 gray target c

executed domins.cxc  

> open C:/Users/hanbi/Figures/v6/domin_comparison/domins.cxc

> color #1 white target c

> color #1:49-60 yellow target c

> color #1:61-101 medium blue target c

> color #1:82-101 forest green target c

> color #1:102-134 purple target c

> color #1:135-169 gray target c

> color #1:170-176 cyan target c

executed domins.cxc  

> open C:/Users/hanbi/Figures/v6/domin_comparison/domins.cxc

> color #1 white target c

> color #1:49-60 yellow target c

> color #1:61-101 medium blue target c

> color #1:82-101 forest green target c

> color #1:102-134 purple target c

> color #1:135-169 gray target c

> color #1:170-176 cyan target c

> color #2 white target c

> color #2:1-48 yellow target c

> color #2:49-60 red target c

> color #2:61-81 forest green target c

> color #2:82-169 medium blue target c

> color #2:170-177 purple target c

> color #2:178 cyan target c

executed domins.cxc  

> hide #1 models

> show #1 models

> hide #2 models

> hide #1 models

> show #1 models

> show #2 models

> hide #2 models

> hide #1 models

> show #2 models

> show #1 models

> hide #2 models

> hide #1 models

> show #2 models

> show #1 models

> open C:/Users/hanbi/Figures/v6/domin_comparison/domins.cxc

> color #1 white target c

> color #1:49-60 yellow target c

> color #1:61-101 medium blue target c

> color #1:82-101 forest green target c

> color #1:102-134 purple target c

> color #1:135-169 gray target c

> color #1:170-176 cyan target c

> color #2 white target c

> color #2:1-48 yellow target c

> color #2:49-60 red target c

> color #2:61-81 forest green target c

> color #2:82-169 cornflower blue target c

> color #2:170-177 purple target c

> color #2:178 cyan target c

executed domins.cxc  

> hide #1 models

> save C:/Users/hanbi/Figures/v6/domin_comparison/domain_comp_240513.cxs

Traceback (most recent call last):  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 917, in save  
session.save(output, version=version, include_maps=include_maps)  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 641, in save  
mgr.discovery(self._state_containers)  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 260, in discovery  
if hasattr(sm, 'include_state') and not sm.include_state(value):  
^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\attributes.py", line 256, in include_state  
self._python_instances = [[inst for inst in inst_func(self.session)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\attributes.py", line 256, in <listcomp>  
self._python_instances = [[inst for inst in inst_func(self.session)  
^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\structure.py", line 2636, in <lambda>  
register_class(reg_class, lambda *args, cls=reg_class:
python_instances_of_class(cls),  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\molobject.py", line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
OSError: exception: access violation reading 0x0000000000000158  
  
OSError: exception: access violation reading 0x0000000000000158  
  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\molobject.py", line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
  
See log for complete Python traceback.  
  
Cannot save
'C:/Users/hanbi/Figures/v6/domin_comparison/domain_comp_240513.cxs':
exception: access violation reading 0x0000000000000158  

> show #1 models

> save C:/Users/hanbi/Figures/v6/domin_comparison/domains_comp_240513.cxs
> includeMaps true

Traceback (most recent call last):  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 917, in save  
session.save(output, version=version, include_maps=include_maps)  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 641, in save  
mgr.discovery(self._state_containers)  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 260, in discovery  
if hasattr(sm, 'include_state') and not sm.include_state(value):  
^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\attributes.py", line 256, in include_state  
self._python_instances = [[inst for inst in inst_func(self.session)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\attributes.py", line 256, in <listcomp>  
self._python_instances = [[inst for inst in inst_func(self.session)  
^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\structure.py", line 2636, in <lambda>  
register_class(reg_class, lambda *args, cls=reg_class:
python_instances_of_class(cls),  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\molobject.py", line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
OSError: exception: access violation reading 0x00000000021B72C2  
  
OSError: exception: access violation reading 0x00000000021B72C2  
  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\molobject.py", line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
  
See log for complete Python traceback.  
  
Cannot save
'C:/Users/hanbi/Figures/v6/domin_comparison/domains_comp_240513.cxs':
exception: access violation reading 0x00000000021B72C2  

> ~select

Nothing selected  

> save C:/Users/hanbi/Figures/v6/domin_comparison/1.cxs includeMaps true

Traceback (most recent call last):  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 917, in save  
session.save(output, version=version, include_maps=include_maps)  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 641, in save  
mgr.discovery(self._state_containers)  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 260, in discovery  
if hasattr(sm, 'include_state') and not sm.include_state(value):  
^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\attributes.py", line 256, in include_state  
self._python_instances = [[inst for inst in inst_func(self.session)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\attributes.py", line 256, in <listcomp>  
self._python_instances = [[inst for inst in inst_func(self.session)  
^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\structure.py", line 2636, in <lambda>  
register_class(reg_class, lambda *args, cls=reg_class:
python_instances_of_class(cls),  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\molobject.py", line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
OSError: exception: access violation reading 0x0000000000000158  
  
OSError: exception: access violation reading 0x0000000000000158  
  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\molobject.py", line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
  
See log for complete Python traceback.  
  
Cannot save 'C:/Users/hanbi/Figures/v6/domin_comparison/1.cxs': exception:
access violation reading 0x0000000000000158  

> close #1

> close

> open C:\Users\hanbi\Figures\v6\domin_comparison\domins.cxc format cmd

> color #1 white target c

> color #1:49-60 yellow target c

> color #1:61-101 medium blue target c

> color #1:82-101 forest green target c

> color #1:102-134 purple target c

> color #1:135-169 gray target c

> color #1:170-176 cyan target c

> color #2 white target c

> color #2:1-48 yellow target c

> color #2:49-60 red target c

> color #2:61-81 forest green target c

> color #2:82-169 cornflower blue target c

> color #2:170-177 purple target c

> color #2:178 cyan target c

executed domins.cxc  

> open C:\Users\hanbi\Figures\v6\domin_comparison\domins.cxc format cmd

> color #1 white target c

> color #1:49-60 yellow target c

> color #1:61-101 medium blue target c

> color #1:82-101 forest green target c

> color #1:102-134 purple target c

> color #1:135-169 gray target c

> color #1:170-176 cyan target c

> color #2 white target c

> color #2:1-48 yellow target c

> color #2:49-60 red target c

> color #2:61-81 forest green target c

> color #2:82-169 cornflower blue target c

> color #2:170-177 purple target c

> color #2:178 cyan target c

executed domins.cxc  

> open "C:/Users/hanbi/Box/Bing, Randall, and
> Anne/AF2models_2.2/Q03135/Human_CAV1_11mer/best_model.pdb"

Chain information for best_model.pdb #1  
---  
Chain | Description  
A B C D E F G H I J K | No description available  
  

> open "C:/Users/hanbi/Box/Bing, Randall, and
> Anne/AF2models_2.2/Q03135/Human_CAV1_11mer/best_model.pdb"

Chain information for best_model.pdb #2  
---  
Chain | Description  
A B C D E F G H I J K | No description available  
  

> show cartoons

> hide atoms

> color #1 white target c

> color #1:49-60 yellow target c

> color #1:61-101 medium blue target c

> color #1:82-101 forest green target c

> color #1:102-134 purple target c

> color #1:135-169 gray target c

> color #1:170-176 cyan target c

> color #2 white target c

> color #2:1-48 yellow target c

> color #2:49-60 red target c

> color #2:61-81 forest green target c

> color #2:82-169 cornflower blue target c

> color #2:170-177 purple target c

> color #2:178 cyan target c

> save C:/Users/hanbi/Figures/v6/domin_comparison/domains_comp_240513.cxs
> includeMaps true

——— End of log from Mon May 13 21:16:42 2024 ———

opened ChimeraX session  

> hide #1 models

> hide #2 models

> show #2 models

> show #1 models

> hide #2 models

> show #2 models

> select /a-f, h-k

28940 atoms, 29740 bonds, 3560 residues, 2 models selected  

> select /a-f, i-k

26046 atoms, 26766 bonds, 3204 residues, 2 models selected  

> hide sel cartoons

> select /g

2894 atoms, 2974 bonds, 356 residues, 2 models selected  

> color sel dark gray

> ~struts

> ~select

Nothing selected  

> save C:/Users/hanbi/Figures/v6/domin_comparison/two_protomers.cxs
> includeMaps true

Traceback (most recent call last):  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 296, in process  
data = sm.take_snapshot(obj, session, self.state_flags)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\structure.py", line 1418, in take_snapshot  
'structure state': Structure.take_snapshot(self, session, flags),  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\structure.py", line 219, in take_snapshot  
'structure state': StructureData.save_state(self, session, flags),  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\molobject.py", line 2005, in save_state  
data['version'] = f(self._c_pointer, data['ints'], data['floats'],
data['misc'])  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
OSError: exception: access violation reading 0x0000000000000009  
  
The above exception was the direct cause of the following exception:  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 273, in discovery  
self.processed[key] = self.process(obj, parents)  
^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 301, in process  
raise RuntimeError(msg) from e  
RuntimeError: Error while saving session data for 'models' ->
<chimerax.core.models.Models object at 0x0000015EF97F1950> ->
<chimerax.atomic.structure.AtomicStructure object at 0x0000015EA1D11DD0>
'best_model.pdb'  
  
During handling of the above exception, another exception occurred:  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 917, in save  
session.save(output, version=version, include_maps=include_maps)  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 641, in save  
mgr.discovery(self._state_containers)  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 277, in discovery  
raise ValueError("error processing: %s: %s" % (_obj_stack(parents, obj), e))  
ValueError: error processing: 'models' -> <chimerax.core.models.Models object
at 0x0000015EF97F1950> -> <chimerax.atomic.structure.AtomicStructure object at
0x0000015EA1D11DD0> 'best_model.pdb': Error while saving session data for
'models' -> <chimerax.core.models.Models object at 0x0000015EF97F1950> ->
<chimerax.atomic.structure.AtomicStructure object at 0x0000015EA1D11DD0>
'best_model.pdb'  
  
ValueError: error processing: 'models' -> -> 'best_model.pdb': Error while
saving session data for 'models' -> -> 'best_model.pdb'  
  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 277, in discovery  
raise ValueError("error processing: %s: %s" % (_obj_stack(parents, obj), e))  
  
See log for complete Python traceback.  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 296, in process  
data = sm.take_snapshot(obj, session, self.state_flags)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\structure.py", line 1418, in take_snapshot  
'structure state': Structure.take_snapshot(self, session, flags),  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\structure.py", line 219, in take_snapshot  
'structure state': StructureData.save_state(self, session, flags),  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\atomic\molobject.py", line 2005, in save_state  
data['version'] = f(self._c_pointer, data['ints'], data['floats'],
data['misc'])  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
OSError: exception: access violation reading 0x0000000000000009  
  
The above exception was the direct cause of the following exception:  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 273, in discovery  
self.processed[key] = self.process(obj, parents)  
^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 301, in process  
raise RuntimeError(msg) from e  
RuntimeError: Error while saving session data for 'models' ->
<chimerax.core.models.Models object at 0x0000015EF97F1950> ->
<chimerax.atomic.structure.AtomicStructure object at 0x0000015EA1D11DD0>
'best_model.pdb'  
  
During handling of the above exception, another exception occurred:  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\save_command\dialog.py", line 127, in <lambda>  
lambda *args, ses=session: show_save_file_dialog(ses), tool_tip="Save output
file",  
^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\save_command\dialog.py", line 138, in show_save_file_dialog  
_dlg.display(session, **kw)  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\save_command\dialog.py", line 62, in display  
run(session, cmd)  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\commands\run.py", line 49, in run  
results = command.run(text, log=log, return_json=return_json)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\commands\cli.py", line 2904, in run  
result = ci.function(session, **kw_args)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\save_command\cmd.py", line 86, in cmd_save  
Command(session, registry=registry).run(provider_cmd_text, log=log)  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\commands\cli.py", line 2904, in run  
result = ci.function(session, **kw_args)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\save_command\cmd.py", line 101, in provider_save  
saver_info.save(session, path, **provider_kw)  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core_formats\\__init__.py", line 95, in save  
return cxs_save(session, path, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 917, in save  
session.save(output, version=version, include_maps=include_maps)  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 641, in save  
mgr.discovery(self._state_containers)  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 277, in discovery  
raise ValueError("error processing: %s: %s" % (_obj_stack(parents, obj), e))  
ValueError: error processing: 'models' -> <chimerax.core.models.Models object
at 0x0000015EF97F1950> -> <chimerax.atomic.structure.AtomicStructure object at
0x0000015EA1D11DD0> 'best_model.pdb': Error while saving session data for
'models' -> <chimerax.core.models.Models object at 0x0000015EF97F1950> ->
<chimerax.atomic.structure.AtomicStructure object at 0x0000015EA1D11DD0>
'best_model.pdb'  
  
ValueError: error processing: 'models' -> -> 'best_model.pdb': Error while
saving session data for 'models' -> -> 'best_model.pdb'  
  
File "C:\Program Files\ChimeraX_daily_032024\bin\Lib\site-
packages\chimerax\core\session.py", line 277, in discovery  
raise ValueError("error processing: %s: %s" % (_obj_stack(parents, obj), e))  
  
See log for complete Python traceback.  
  




OpenGL version: 3.3.0 NVIDIA 528.92
OpenGL renderer: NVIDIA GeForce RTX 3060 Laptop GPU/PCIe/SSE2
OpenGL vendor: NVIDIA Corporation

Python: 3.11.4
Locale: en_US.cp1252
Qt version: PyQt6 6.6.1, Qt 6.6.1
Qt runtime version: 6.6.2
Qt platform: windows

Manufacturer: Micro-Star International Co., Ltd.
Model: Raider GE76 12UE
OS: Microsoft Windows 11 Home (Build 22631)
Memory: 16,866,566,144
MaxProcessMemory: 137,438,953,344
CPU: 20 12th Gen Intel(R) Core(TM) i9-12900H
OSLanguage: en-US

Installed Packages:
    alabaster: 0.7.16
    appdirs: 1.4.4
    asttokens: 2.4.1
    Babel: 2.14.0
    beautifulsoup4: 4.12.3
    blockdiag: 3.0.0
    blosc2: 2.5.1
    build: 1.1.1
    certifi: 2024.2.2
    cftime: 1.6.3
    charset-normalizer: 3.3.2
    ChimeraX-AddCharge: 1.5.16
    ChimeraX-AddH: 2.2.5
    ChimeraX-AlignmentAlgorithms: 2.0.1
    ChimeraX-AlignmentHdrs: 3.4.3
    ChimeraX-AlignmentMatrices: 2.1
    ChimeraX-Alignments: 2.12.5
    ChimeraX-AlphaFold: 1.0
    ChimeraX-AltlocExplorer: 1.1.1
    ChimeraX-AmberInfo: 1.0
    ChimeraX-Arrays: 1.1
    ChimeraX-Atomic: 1.56
    ChimeraX-AtomicLibrary: 14.0.2
    ChimeraX-AtomSearch: 2.0.1
    ChimeraX-AxesPlanes: 2.4
    ChimeraX-BasicActions: 1.1.2
    ChimeraX-BILD: 1.0
    ChimeraX-BlastProtein: 2.1.2
    ChimeraX-BondRot: 2.0.4
    ChimeraX-BugReporter: 1.0.1
    ChimeraX-BuildStructure: 2.12.1
    ChimeraX-Bumps: 1.0
    ChimeraX-BundleBuilder: 1.2.2
    ChimeraX-ButtonPanel: 1.0.1
    ChimeraX-CageBuilder: 1.0.1
    ChimeraX-CellPack: 1.0
    ChimeraX-Centroids: 1.4
    ChimeraX-ChangeChains: 1.1
    ChimeraX-CheckWaters: 1.4
    ChimeraX-ChemGroup: 2.0.1
    ChimeraX-Clashes: 2.2.4
    ChimeraX-ColorActions: 1.0.3
    ChimeraX-ColorGlobe: 1.0
    ChimeraX-ColorKey: 1.5.5
    ChimeraX-CommandLine: 1.2.5
    ChimeraX-ConnectStructure: 2.0.1
    ChimeraX-Contacts: 1.0.1
    ChimeraX-Core: 1.8.dev202403200605
    ChimeraX-CoreFormats: 1.2
    ChimeraX-coulombic: 1.4.3
    ChimeraX-Crosslinks: 1.0
    ChimeraX-Crystal: 1.0
    ChimeraX-CrystalContacts: 1.0.1
    ChimeraX-DataFormats: 1.2.3
    ChimeraX-Dicom: 1.2
    ChimeraX-DistMonitor: 1.4.2
    ChimeraX-DockPrep: 1.1.3
    ChimeraX-Dssp: 2.0
    ChimeraX-EMDB-SFF: 1.0
    ChimeraX-ESMFold: 1.0
    ChimeraX-FileHistory: 1.0.1
    ChimeraX-FunctionKey: 1.0.1
    ChimeraX-Geometry: 1.3
    ChimeraX-gltf: 1.0
    ChimeraX-Graphics: 1.1.1
    ChimeraX-Hbonds: 2.4
    ChimeraX-Help: 1.2.2
    ChimeraX-HKCage: 1.3
    ChimeraX-IHM: 1.1
    ChimeraX-ImageFormats: 1.2
    ChimeraX-IMOD: 1.0
    ChimeraX-IO: 1.0.1
    ChimeraX-ItemsInspection: 1.0.1
    ChimeraX-IUPAC: 1.0
    ChimeraX-Label: 1.1.9
    ChimeraX-ListInfo: 1.2.2
    ChimeraX-Log: 1.1.6
    ChimeraX-LookingGlass: 1.1
    ChimeraX-Maestro: 1.9.1
    ChimeraX-Map: 1.1.4
    ChimeraX-MapData: 2.0
    ChimeraX-MapEraser: 1.0.1
    ChimeraX-MapFilter: 2.0.1
    ChimeraX-MapFit: 2.0
    ChimeraX-MapSeries: 2.1.1
    ChimeraX-Markers: 1.0.1
    ChimeraX-Mask: 1.0.2
    ChimeraX-MatchMaker: 2.1.3
    ChimeraX-MCopy: 1.0
    ChimeraX-MDcrds: 2.7
    ChimeraX-MedicalToolbar: 1.0.2
    ChimeraX-Meeting: 1.0.1
    ChimeraX-MLP: 1.1.1
    ChimeraX-mmCIF: 2.13
    ChimeraX-MMTF: 2.2
    ChimeraX-Modeller: 1.5.15
    ChimeraX-ModelPanel: 1.5
    ChimeraX-ModelSeries: 1.0.1
    ChimeraX-Mol2: 2.0.3
    ChimeraX-Mole: 1.0
    ChimeraX-Morph: 1.0.2
    ChimeraX-MouseModes: 1.2
    ChimeraX-Movie: 1.0
    ChimeraX-Neuron: 1.0
    ChimeraX-Nifti: 1.1
    ChimeraX-NMRSTAR: 1.0.2
    ChimeraX-NRRD: 1.1
    ChimeraX-Nucleotides: 2.0.3
    ChimeraX-OpenCommand: 1.13.3
    ChimeraX-PDB: 2.7.5
    ChimeraX-PDBBio: 1.0.1
    ChimeraX-PDBLibrary: 1.0.4
    ChimeraX-PDBMatrices: 1.0
    ChimeraX-PickBlobs: 1.0.1
    ChimeraX-Positions: 1.0
    ChimeraX-PresetMgr: 1.1.1
    ChimeraX-PubChem: 2.1
    ChimeraX-ReadPbonds: 1.0.1
    ChimeraX-Registration: 1.1.2
    ChimeraX-RemoteControl: 1.0
    ChimeraX-RenderByAttr: 1.3
    ChimeraX-RenumberResidues: 1.1
    ChimeraX-ResidueFit: 1.0.1
    ChimeraX-RestServer: 1.2
    ChimeraX-RNALayout: 1.0
    ChimeraX-RotamerLibMgr: 4.0
    ChimeraX-RotamerLibsDunbrack: 2.0
    ChimeraX-RotamerLibsDynameomics: 2.0
    ChimeraX-RotamerLibsRichardson: 2.0
    ChimeraX-SaveCommand: 1.5.1
    ChimeraX-SchemeMgr: 1.0
    ChimeraX-SDF: 2.0.2
    ChimeraX-Segger: 1.0
    ChimeraX-Segment: 1.0.1
    ChimeraX-Segmentations: 1.0
    ChimeraX-SelInspector: 1.0
    ChimeraX-SeqView: 2.11.2
    ChimeraX-Shape: 1.0.1
    ChimeraX-Shell: 1.0.1
    ChimeraX-Shortcuts: 1.1.1
    ChimeraX-ShowSequences: 1.0.3
    ChimeraX-SideView: 1.0.1
    ChimeraX-Smiles: 2.1.2
    ChimeraX-SmoothLines: 1.0
    ChimeraX-SpaceNavigator: 1.0
    ChimeraX-StdCommands: 1.16.3
    ChimeraX-STL: 1.0.1
    ChimeraX-Storm: 1.0
    ChimeraX-StructMeasure: 1.2
    ChimeraX-Struts: 1.0.1
    ChimeraX-Surface: 1.0.1
    ChimeraX-SwapAA: 2.0.1
    ChimeraX-SwapRes: 2.5
    ChimeraX-TapeMeasure: 1.0
    ChimeraX-TaskManager: 1.0
    ChimeraX-Test: 1.0
    ChimeraX-Toolbar: 1.1.2
    ChimeraX-ToolshedUtils: 1.2.4
    ChimeraX-Topography: 1.0
    ChimeraX-ToQuest: 1.0
    ChimeraX-Tug: 1.0.1
    ChimeraX-UI: 1.37.1
    ChimeraX-uniprot: 2.3
    ChimeraX-UnitCell: 1.0.1
    ChimeraX-ViewDockX: 1.3.2
    ChimeraX-VIPERdb: 1.0
    ChimeraX-Vive: 1.1
    ChimeraX-VolumeMenu: 1.0.1
    ChimeraX-vrml: 1.0
    ChimeraX-VTK: 1.0
    ChimeraX-WavefrontOBJ: 1.0
    ChimeraX-WebCam: 1.0.2
    ChimeraX-WebServices: 1.1.3
    ChimeraX-Zone: 1.0.1
    colorama: 0.4.6
    comm: 0.2.2
    comtypes: 1.3.1
    contourpy: 1.2.0
    cxservices: 1.2.2
    cycler: 0.12.1
    Cython: 3.0.9
    debugpy: 1.8.1
    decorator: 5.1.1
    docutils: 0.20.1
    executing: 2.0.1
    filelock: 3.13.1
    fonttools: 4.50.0
    funcparserlib: 2.0.0a0
    glfw: 2.7.0
    grako: 3.16.5
    h5py: 3.10.0
    html2text: 2024.2.26
    idna: 3.6
    ihm: 0.43
    imagecodecs: 2024.1.1
    imagesize: 1.4.1
    ipykernel: 6.29.2
    ipython: 8.21.0
    ipywidgets: 8.1.2
    jedi: 0.19.1
    Jinja2: 3.1.3
    jupyter-client: 8.6.0
    jupyter-core: 5.7.2
    jupyterlab-widgets: 3.0.10
    kiwisolver: 1.4.5
    line-profiler: 4.1.2
    lxml: 5.1.0
    lz4: 4.3.3
    MarkupSafe: 2.1.5
    matplotlib: 3.8.3
    matplotlib-inline: 0.1.6
    msgpack: 1.0.8
    ndindex: 1.8
    nest-asyncio: 1.6.0
    netCDF4: 1.6.5
    networkx: 3.2.1
    nibabel: 5.0.1
    nptyping: 2.5.0
    numexpr: 2.9.0
    numpy: 1.26.4
    openvr: 1.26.701
    packaging: 24.0
    ParmEd: 4.2.2
    parso: 0.8.3
    pep517: 0.13.1
    pillow: 10.2.0
    pip: 24.0
    pkginfo: 1.10.0
    platformdirs: 4.2.0
    prompt-toolkit: 3.0.43
    psutil: 5.9.8
    pure-eval: 0.2.2
    py-cpuinfo: 9.0.0
    pycollada: 0.8
    pydicom: 2.3.0
    pygments: 2.17.2
    pynmrstar: 3.3.4
    pynrrd: 1.0.0
    PyOpenGL: 3.1.7
    PyOpenGL-accelerate: 3.1.7
    pyopenxr: 1.0.3302
    pyparsing: 3.1.2
    pyproject-hooks: 1.0.0
    PyQt6-commercial: 6.6.1
    PyQt6-Qt6: 6.6.2
    PyQt6-sip: 13.6.0
    PyQt6-WebEngine-commercial: 6.6.0
    PyQt6-WebEngine-Qt6: 6.6.2
    python-dateutil: 2.9.0.post0
    pytz: 2024.1
    pywin32: 306
    pyzmq: 25.1.2
    qtconsole: 5.5.1
    QtPy: 2.4.1
    RandomWords: 0.4.0
    requests: 2.31.0
    scipy: 1.12.0
    setuptools: 69.2.0
    sfftk-rw: 0.8.1
    six: 1.16.0
    snowballstemmer: 2.2.0
    sortedcontainers: 2.4.0
    soupsieve: 2.5
    sphinx: 7.2.6
    sphinx-autodoc-typehints: 2.0.0
    sphinxcontrib-applehelp: 1.0.8
    sphinxcontrib-blockdiag: 3.0.0
    sphinxcontrib-devhelp: 1.0.6
    sphinxcontrib-htmlhelp: 2.0.5
    sphinxcontrib-jsmath: 1.0.1
    sphinxcontrib-qthelp: 1.0.7
    sphinxcontrib-serializinghtml: 1.1.10
    stack-data: 0.6.3
    superqt: 0.6.1
    tables: 3.9.2
    tcia-utils: 1.5.1
    tifffile: 2024.1.30
    tinyarray: 1.2.4
    tornado: 6.4
    traitlets: 5.14.1
    typing-extensions: 4.10.0
    tzdata: 2024.1
    urllib3: 2.2.1
    wcwidth: 0.2.13
    webcolors: 1.13
    wheel: 0.43.0
    wheel-filename: 1.4.1
    widgetsnbextension: 4.0.10
    WMI: 1.5.1