Opened 19 months ago
Closed 19 months ago
#14900 closed defect (duplicate)
Crash in python_instances_of_class
Reported by: | Owned by: | pett | |
---|---|---|---|
Priority: | normal | Milestone: | |
Component: | Core | Version: | |
Keywords: | Cc: | Tom Goddard | |
Blocked By: | Blocking: | ||
Notify when closed: | Platform: | all | |
Project: | ChimeraX |
Description
The following bug report has been submitted: Platform: Windows-10-10.0.22621 ChimeraX Version: 1.8.dev202403200605 (2024-03-20 06:05:36 UTC) Description (Describe the actions that caused this problem to occur here) Log: UCSF ChimeraX version: 1.8.dev202403200605 (2024-03-20) © 2016-2024 Regents of the University of California. All rights reserved. How to cite UCSF ChimeraX > ui tool show AlphaFold > alphafold predict EIVPNSAEEREIVPNSAEEREIVPNSAEEREIVPNSAEEREIVPNSAEER Please cite ColabFold: Making protein folding accessible to all. Nature Methods (2022) if you use these predictions. Running AlphaFold prediction [Repeated 1 time(s)]Alphafold prediction send sequence to Google Colab returned: None Running AlphaFold prediction AlphaFold prediction finished Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4 > open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4\best_model.pdb Chain information for best_model.pdb #1 --- Chain | Description A | No description available > alphafold predict > SKDIGSESTEDQAMESKDIGSESTEDQAMESKDIGSESTEDQAMESKDIGSESTEDQAMESKDIGSESTEDQAME Running AlphaFold prediction Compositor returned null texture [Repeated 1 time(s)]AlphaFold prediction finished Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4 > open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4\best_model.pdb Chain information for best_model.pdb #2 --- Chain | Description A | No description available > hide #1 models > coulombic #2 Using Amber 20 recommended default charges and atom types for standard residues Coulombic values for best_model.pdb_A SES surface #2.1: minimum, -28.22, mean -7.39, maximum 6.28 To also show corresponding color key, enter the above coulombic command and add key true > hide #!2 surfaces > hide #!2 models > alphafold predict > SKDIGSESTEDQAMESKDIGSESTEDQAMESKDIGSESTEDQAMESKDIGSESTEDQAMESKDIGSESTEDQAME Running AlphaFold prediction AlphaFold prediction finished Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_5 > open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_5\best_model.pdb Chain information for best_model.pdb #3 --- Chain | Description A | No description available > hide #3 models > show #!2 models > hide #!2 target m > close #2 > show #1 models > show #3 models > hide #1 models > hide #3 models > alphafold predict > SEEIVPNSVEQKSEEIVPNSVEQKSEEIVPNSVEQKSEEIVPNSVEQKSEEIVPNSVEQK Running AlphaFold prediction AlphaFold prediction finished Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4 > open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4\best_model.pdb Chain information for best_model.pdb #2 --- Chain | Description A | No description available > hide #2 models > show #3 models > show #2 models > show #1 models > hide #2 models > hide #3 models > hide #1 models > show #1 models > show #2 models > show #3 models > hide #1 models > show #1 models > hide #2 models > show #2 models > hide #3 models > show #3 models > alphafold predict > DIGSESTEDQAMEDIMDIGSESTEDQAMEDIMDIGSESTEDQAMEDIMDIGSESTEDQAMEDIMDIGSESTEDQAMEDIM [Repeated 1 time(s)]Running AlphaFold prediction Alphafold prediction send sequence to Google Colab returned: None > alphafold predict > DIGSESTEDQAMEDIMDIGSESTEDQAMEDIMDIGSESTEDQAMEDIMDIGSESTEDQAMEDIMDIGSESTEDQAMEDIM Running AlphaFold prediction AlphaFold prediction finished Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4 > open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4\best_model.pdb Chain information for best_model.pdb #4 --- Chain | Description A | No description available > hide #1 models > hide #2 models > hide #3 models > coulombic #4 Using Amber 20 recommended default charges and atom types for standard residues Coulombic values for best_model.pdb_A SES surface #4.1: minimum, -36.24, mean -10.35, maximum 3.39 To also show corresponding color key, enter the above coulombic command and add key true > coulombic #!4 Coulombic values for best_model.pdb_A SES surface #4.1: minimum, -36.24, mean -10.35, maximum 3.39 To also show corresponding color key, enter the above coulombic command and add key true > coulombic #!4 Coulombic values for best_model.pdb_A SES surface #4.1: minimum, -36.24, mean -10.35, maximum 3.39 To also show corresponding color key, enter the above coulombic command and add key true > hide #!4 surfaces > alphafold predict > QMEAESISSSEEIVPNSVEQKQMEAESISSSEEIVPNSVEQKQMEAESISSSEEIVPNSVEQKQMEAESISSSEEIVPNSVEQKQMEAESISSSEEIVPNSVEQK Running AlphaFold prediction > hide #!4 models Compositor returned null texture AlphaFold prediction finished Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4 > open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4\best_model.pdb Chain information for best_model.pdb #5 --- Chain | Description A | No description available > coulombic #5 Using Amber 20 recommended default charges and atom types for standard residues Coulombic values for best_model.pdb_A SES surface #5.1: minimum, -22.35, mean -4.85, maximum 7.19 To also show corresponding color key, enter the above coulombic command and add key true > coulombic #!5 Coulombic values for best_model.pdb_A SES surface #5.1: minimum, -22.35, mean -4.85, maximum 7.19 To also show corresponding color key, enter the above coulombic command and add key true > hide #!5 surfaces > alphafold predict VPNSAEERVPNSAEERVPNSAEERVPNSAEERVPNSAEER > hide #!5 models > show #!5 models Running AlphaFold prediction > hide #!5 models AlphaFold prediction finished Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4 > open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4\best_model.pdb Chain information for best_model.pdb #6 --- Chain | Description A | No description available Compositor returned null texture > alphafold predict > IVESLSSSEESITRIVESLSSSEESITRIVESLSSSEESITRIVESLSSSEESITRIVESLSSSEESITR Running AlphaFold prediction AlphaFold prediction finished Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4 > open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4\best_model.pdb Chain information for best_model.pdb #7 --- Chain | Description A | No description available > hide #6 models > hide #7 surfaces > coulombic #7 Using Amber 20 recommended default charges and atom types for standard residues Coulombic values for best_model.pdb_A SES surface #7.1: minimum, -12.25, mean -3.87, maximum 8.30 To also show corresponding color key, enter the above coulombic command and add key true > hide #!7 surfaces > alphafold predict > FQSEEQQQTEDEFQSEEQQQTEDEFQSEEQQQTEDEFQSEEQQQTEDEFQSEEQQQTEDE Running AlphaFold prediction Compositor returned null texture AlphaFold prediction finished Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4 > open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4\best_model.pdb Chain information for best_model.pdb #8 --- Chain | Description A | No description available > hide #!7 models > alphafold predict > FQSEEQQQTEDELQDKFQSEEQQQTEDELQDKFQSEEQQQTEDELQDKFQSEEQQQTEDELQDKFQSEEQQQTEDELQDK Running AlphaFold prediction AlphaFold prediction finished Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4 > open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4\best_model.pdb Chain information for best_model.pdb #9 --- Chain | Description A | No description available > hide #8 models > alphafold predict > RELEELNVPGEIVESLSSSEESITRINKRELEELNVPGEIVESLSSSEESITRINKRELEELNVPGEIVESLSSSEESITRINKRELEELNVPGEIVESLSSSEESITRINKRELEELNVPGEIVESLSSSEESITRINK Running AlphaFold prediction AlphaFold prediction finished Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4 > open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4\best_model.pdb Chain information for best_model.pdb #10 --- Chain | Description A | No description available > hide #9 models > coulombic #10 Traceback (most recent call last): File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\toolbar\tool.py", line 205, in callback bundle_info.run_provider(session, name, session.toolbar, display_name=display_name) File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\core\toolshed\info.py", line 397, in run_provider return api._api_caller.run_provider(api, session, name, mgr, **kw) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\core\toolshed\\__init__.py", line 1302, in run_provider return cls._get_func(api, "run_provider")(session, name, mgr, **kw) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\\__init__.py", line 66, in run_provider shortcuts.run_provider(session, name) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 1387, in run_provider keyboard_shortcuts(session).try_shortcut(name) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 402, in try_shortcut self.run_shortcut(keys) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 420, in run_shortcut sc.run(self.session, status = self._enabled) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 339, in run f(s) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 72, in func_plus_tip func(cmd + " %s")(session) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 593, in run_expanded_command run(session, cmd) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 536, in run run_command(session, command, **kw) File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\core\commands\run.py", line 49, in run results = command.run(text, log=log, return_json=return_json) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\core\commands\cli.py", line 2904, in run result = ci.function(session, **kw_args) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\coulombic\cmd.py", line 102, in cmd_coulombic assign_charges(session, needs_assignment, his_scheme, charge_method, File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\coulombic\coulombic.py", line 73, in assign_charges charged_struct = struct.copy(name="copy of " + struct.name) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py", line 162, in copy m._copy_custom_attrs(self) File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py", line 176, in _copy_custom_attrs py_objs = [py_obj for py_obj in python_instances_of_class(class_obj) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py", line 44, in python_instances_of_class instances = f(inst_class) ^^^^^^^^^^^^^ OSError: exception: access violation writing 0x00007FFC3C709C50 OSError: exception: access violation writing 0x00007FFC3C709C50 File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py", line 44, in python_instances_of_class instances = f(inst_class) ^^^^^^^^^^^^^ See log for complete Python traceback. > coulombic #10 Traceback (most recent call last): File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\toolbar\tool.py", line 205, in callback bundle_info.run_provider(session, name, session.toolbar, display_name=display_name) File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\core\toolshed\info.py", line 397, in run_provider return api._api_caller.run_provider(api, session, name, mgr, **kw) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\core\toolshed\\__init__.py", line 1302, in run_provider return cls._get_func(api, "run_provider")(session, name, mgr, **kw) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\\__init__.py", line 66, in run_provider shortcuts.run_provider(session, name) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 1387, in run_provider keyboard_shortcuts(session).try_shortcut(name) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 402, in try_shortcut self.run_shortcut(keys) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 420, in run_shortcut sc.run(self.session, status = self._enabled) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 339, in run f(s) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 72, in func_plus_tip func(cmd + " %s")(session) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 593, in run_expanded_command run(session, cmd) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 536, in run run_command(session, command, **kw) File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\core\commands\run.py", line 49, in run results = command.run(text, log=log, return_json=return_json) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\core\commands\cli.py", line 2904, in run result = ci.function(session, **kw_args) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\coulombic\cmd.py", line 102, in cmd_coulombic assign_charges(session, needs_assignment, his_scheme, charge_method, File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\coulombic\coulombic.py", line 73, in assign_charges charged_struct = struct.copy(name="copy of " + struct.name) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py", line 162, in copy m._copy_custom_attrs(self) File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py", line 176, in _copy_custom_attrs py_objs = [py_obj for py_obj in python_instances_of_class(class_obj) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py", line 44, in python_instances_of_class instances = f(inst_class) ^^^^^^^^^^^^^ OSError: exception: access violation writing 0x00007FFC3C709C50 OSError: exception: access violation writing 0x00007FFC3C709C50 File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py", line 44, in python_instances_of_class instances = f(inst_class) ^^^^^^^^^^^^^ See log for complete Python traceback. > hide #10 models > open > C:/Users/piyus/Downloads/ChimeraX/AlphaFold/prediction_4/af140_unrelaxed_rank_001_alphafold2_ptm_model_4_seed_000.pdb Chain information for af140_unrelaxed_rank_001_alphafold2_ptm_model_4_seed_000.pdb #11 --- Chain | Description A | No description available > rainbow #11 > coulombic #11 Using Amber 20 recommended default charges and atom types for standard residues Coulombic values for af140_unrelaxed_rank_001_alphafold2_ptm_model_4_seed_000.pdb_A SES surface #11.1: minimum, -16.21, mean -5.15, maximum 7.09 To also show corresponding color key, enter the above coulombic command and add key true > hide #!11 surfaces > rainbow #!11 > hide #!11 atoms > hide #!11 cartoons > show #!11 cartoons > hide #!11 surfaces [Repeated 2 time(s)] > hide #!11 atoms [Repeated 1 time(s)] > alphafold predict > IVESLSSSEESIIVESLSSSEESIIVESLSSSEESIIVESLSSSEESIIVESLSSSEESI Running AlphaFold prediction AlphaFold prediction finished Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4 > open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4\best_model.pdb Chain information for best_model.pdb #12 --- Chain | Description A | No description available > hide #!11 models > coulombic #12 Using Amber 20 recommended default charges and atom types for standard residues Coulombic values for best_model.pdb_A SES surface #12.1: minimum, -22.22, mean -7.81, maximum 4.04 To also show corresponding color key, enter the above coulombic command and add key true > coulombic #!12 Coulombic values for best_model.pdb_A SES surface #12.1: minimum, -22.22, mean -7.81, maximum 4.04 To also show corresponding color key, enter the above coulombic command and add key true > show #2 models > hide #!12 models > hide #2 models > show #3 models > hide #3 models > open "C:/Users/piyus/Downloads/ChimeraX/AlphaFold/biofunctional peptide Jan > 4 - 5 repeats/af80_unrelaxed_rank_001_alphafold2_ptm_model_1_seed_000.pdb" Chain information for af80_unrelaxed_rank_001_alphafold2_ptm_model_1_seed_000.pdb #13 --- Chain | Description A | No description available > hide #13 models > show #13 models > open "C:/Users/piyus/Downloads/ChimeraX/AlphaFold/biofunctional peptide Jan > 5 - 5 repeats/af105_unrelaxed_rank_001_alphafold2_ptm_model_3_seed_000.pdb" Chain information for af105_unrelaxed_rank_001_alphafold2_ptm_model_3_seed_000.pdb #14 --- Chain | Description A | No description available > hide #14 models > open "C:/Users/piyus/Downloads/ChimeraX/AlphaFold/biofunctional peptide Jan > 6 - 5 repeats/af40_unrelaxed_rank_001_alphafold2_ptm_model_1_seed_000.pdb" Chain information for af40_unrelaxed_rank_001_alphafold2_ptm_model_1_seed_000.pdb #15 --- Chain | Description A | No description available > hide #15 models > open "C:/Users/piyus/Downloads/ChimeraX/AlphaFold/Bioactive casein March 1 - > 5 repeats/af70_unrelaxed_rank_001_alphafold2_ptm_model_3_seed_000.pdb" Chain information for af70_unrelaxed_rank_001_alphafold2_ptm_model_3_seed_000.pdb #16 --- Chain | Description A | No description available > hide #16 models > show #16 models > hide #16 models > hide #13 models > open "C:/Users/piyus/Downloads/ChimeraX/AlphaFold/Bioactive casein March 2 - > 5 repeats/af60_unrelaxed_rank_001_alphafold2_ptm_model_5_seed_000.pdb" Chain information for af60_unrelaxed_rank_001_alphafold2_ptm_model_5_seed_000.pdb #17 --- Chain | Description A | No description available > hide #17 models > open "C:/Users/piyus/Downloads/ChimeraX/AlphaFold/biofunctional peptide > March 3 - 5 > repeats/af80_unrelaxed_rank_001_alphafold2_ptm_model_5_seed_000.pdb" Chain information for af80_unrelaxed_rank_001_alphafold2_ptm_model_5_seed_000.pdb #18 --- Chain | Description A | No description available > hide #18 models > open "C:/Users/piyus/Downloads/ChimeraX/AlphaFold/biofunctional peptide > March 4 - 5 > repeats/af140_unrelaxed_rank_001_alphafold2_ptm_model_4_seed_000.pdb" Chain information for af140_unrelaxed_rank_001_alphafold2_ptm_model_4_seed_000.pdb #19 --- Chain | Description A | No description available > rainbow #19 > coulombic #19 Using Amber 20 recommended default charges and atom types for standard residues Coulombic values for af140_unrelaxed_rank_001_alphafold2_ptm_model_4_seed_000.pdb_A SES surface #19.1: minimum, -16.21, mean -5.15, maximum 7.09 To also show corresponding color key, enter the above coulombic command and add key true > hide #!19 surfaces > hide #!19 models > open "C:/Users/piyus/Downloads/ChimeraX/AlphaFold/biofunctional peptide > March 4 - 5 > repeats/af140_unrelaxed_rank_001_alphafold2_ptm_model_4_seed_000.pdb" Chain information for af140_unrelaxed_rank_001_alphafold2_ptm_model_4_seed_000.pdb #20 --- Chain | Description A | No description available > hide #20 models > show #1 models > show #2 models > show #3 models > show #!4 models > show #!5 models > close > ui tool show AlphaFold > alphafold predict > KNTMEHVSSSEESIISQETYKQEKNMAINPSKKNTMEHVSSSEESIISQETYKQEKNMAINPSKKNTMEHVSSSEESIISQETYKQEKNMAINPSKKNTMEHVSSSEESIISQETYKQEKNMAINPSKKNTMEHVSSSEESIISQETYKQEKNMAINPSK Running AlphaFold prediction AlphaFold prediction finished Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4 > open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4\best_model.pdb Chain information for best_model.pdb #1 --- Chain | Description A | No description available AlphaFold prediction finished Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4 > open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_4\best_model.pdb Chain information for best_model.pdb #2 --- Chain | Description A | No description available > coulombic Traceback (most recent call last): File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\toolbar\tool.py", line 205, in callback bundle_info.run_provider(session, name, session.toolbar, display_name=display_name) File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\core\toolshed\info.py", line 397, in run_provider return api._api_caller.run_provider(api, session, name, mgr, **kw) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\core\toolshed\\__init__.py", line 1302, in run_provider return cls._get_func(api, "run_provider")(session, name, mgr, **kw) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\\__init__.py", line 66, in run_provider shortcuts.run_provider(session, name) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 1387, in run_provider keyboard_shortcuts(session).try_shortcut(name) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 402, in try_shortcut self.run_shortcut(keys) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 420, in run_shortcut sc.run(self.session, status = self._enabled) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 339, in run f(s) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 72, in func_plus_tip func(cmd + " %s")(session) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 593, in run_expanded_command run(session, cmd) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 536, in run run_command(session, command, **kw) File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\core\commands\run.py", line 49, in run results = command.run(text, log=log, return_json=return_json) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\core\commands\cli.py", line 2904, in run result = ci.function(session, **kw_args) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\coulombic\cmd.py", line 102, in cmd_coulombic assign_charges(session, needs_assignment, his_scheme, charge_method, File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\coulombic\coulombic.py", line 73, in assign_charges charged_struct = struct.copy(name="copy of " + struct.name) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py", line 162, in copy m._copy_custom_attrs(self) File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py", line 176, in _copy_custom_attrs py_objs = [py_obj for py_obj in python_instances_of_class(class_obj) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py", line 61, in python_instances_of_class return [x for x in instances if filt(x)] ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py", line 61, in <listcomp> return [x for x in instances if filt(x)] ^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py", line 52, in <lambda> filt = lambda x: open_structure(x.structure) ^^^^^^^^^^^ File "atomic_cpp\\\cymol.pyx", line 536, in chimerax.atomic.cymol.CyAtom.structure.__get__ RuntimeError: Atom already deleted RuntimeError: Atom already deleted File "atomic_cpp\\\cymol.pyx", line 536, in chimerax.atomic.cymol.CyAtom.structure.__get__ See log for complete Python traceback. > coulombic Traceback (most recent call last): File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\toolbar\tool.py", line 205, in callback bundle_info.run_provider(session, name, session.toolbar, display_name=display_name) File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\core\toolshed\info.py", line 397, in run_provider return api._api_caller.run_provider(api, session, name, mgr, **kw) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\core\toolshed\\__init__.py", line 1302, in run_provider return cls._get_func(api, "run_provider")(session, name, mgr, **kw) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\\__init__.py", line 66, in run_provider shortcuts.run_provider(session, name) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 1387, in run_provider keyboard_shortcuts(session).try_shortcut(name) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 402, in try_shortcut self.run_shortcut(keys) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 420, in run_shortcut sc.run(self.session, status = self._enabled) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 339, in run f(s) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 72, in func_plus_tip func(cmd + " %s")(session) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 593, in run_expanded_command run(session, cmd) File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\shortcuts\shortcuts.py", line 536, in run run_command(session, command, **kw) File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\core\commands\run.py", line 49, in run results = command.run(text, log=log, return_json=return_json) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\core\commands\cli.py", line 2904, in run result = ci.function(session, **kw_args) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\coulombic\cmd.py", line 102, in cmd_coulombic assign_charges(session, needs_assignment, his_scheme, charge_method, File "C:\Users\ChimeraX\bin\Lib\site- packages\chimerax\coulombic\coulombic.py", line 73, in assign_charges charged_struct = struct.copy(name="copy of " + struct.name) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py", line 162, in copy m._copy_custom_attrs(self) File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py", line 176, in _copy_custom_attrs py_objs = [py_obj for py_obj in python_instances_of_class(class_obj) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py", line 61, in python_instances_of_class return [x for x in instances if filt(x)] ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py", line 61, in <listcomp> return [x for x in instances if filt(x)] ^^^^^^^ File "C:\Users\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py", line 52, in <lambda> filt = lambda x: open_structure(x.structure) ^^^^^^^^^^^ File "atomic_cpp\\\cymol.pyx", line 536, in chimerax.atomic.cymol.CyAtom.structure.__get__ RuntimeError: Atom already deleted RuntimeError: Atom already deleted File "atomic_cpp\\\cymol.pyx", line 536, in chimerax.atomic.cymol.CyAtom.structure.__get__ See log for complete Python traceback. OpenGL version: 3.3.0 - Build 30.0.101.1692 OpenGL renderer: Intel(R) UHD Graphics OpenGL vendor: Intel Python: 3.11.4 Locale: en_IN.cp1252 Qt version: PyQt6 6.6.1, Qt 6.6.1 Qt runtime version: 6.6.2 Qt platform: windows Manufacturer: LENOVO Model: 81X7 OS: Microsoft Windows 11 Home Single Language (Build 22621) Memory: 8,379,490,304 MaxProcessMemory: 137,438,953,344 CPU: 4 11th Gen Intel(R) Core(TM) i3-1115G4 @ 3.00GHz OSLanguage: en-US Installed Packages: alabaster: 0.7.16 appdirs: 1.4.4 asttokens: 2.4.1 Babel: 2.14.0 beautifulsoup4: 4.12.3 blockdiag: 3.0.0 blosc2: 2.5.1 build: 1.1.1 certifi: 2024.2.2 cftime: 1.6.3 charset-normalizer: 3.3.2 ChimeraX-AddCharge: 1.5.16 ChimeraX-AddH: 2.2.5 ChimeraX-AlignmentAlgorithms: 2.0.1 ChimeraX-AlignmentHdrs: 3.4.3 ChimeraX-AlignmentMatrices: 2.1 ChimeraX-Alignments: 2.12.5 ChimeraX-AlphaFold: 1.0 ChimeraX-AltlocExplorer: 1.1.1 ChimeraX-AmberInfo: 1.0 ChimeraX-Arrays: 1.1 ChimeraX-Atomic: 1.56 ChimeraX-AtomicLibrary: 14.0.2 ChimeraX-AtomSearch: 2.0.1 ChimeraX-AxesPlanes: 2.4 ChimeraX-BasicActions: 1.1.2 ChimeraX-BILD: 1.0 ChimeraX-BlastProtein: 2.1.2 ChimeraX-BondRot: 2.0.4 ChimeraX-BugReporter: 1.0.1 ChimeraX-BuildStructure: 2.12.1 ChimeraX-Bumps: 1.0 ChimeraX-BundleBuilder: 1.2.2 ChimeraX-ButtonPanel: 1.0.1 ChimeraX-CageBuilder: 1.0.1 ChimeraX-CellPack: 1.0 ChimeraX-Centroids: 1.4 ChimeraX-ChangeChains: 1.1 ChimeraX-CheckWaters: 1.4 ChimeraX-ChemGroup: 2.0.1 ChimeraX-Clashes: 2.2.4 ChimeraX-ColorActions: 1.0.3 ChimeraX-ColorGlobe: 1.0 ChimeraX-ColorKey: 1.5.5 ChimeraX-CommandLine: 1.2.5 ChimeraX-ConnectStructure: 2.0.1 ChimeraX-Contacts: 1.0.1 ChimeraX-Core: 1.8.dev202403200605 ChimeraX-CoreFormats: 1.2 ChimeraX-coulombic: 1.4.3 ChimeraX-Crosslinks: 1.0 ChimeraX-Crystal: 1.0 ChimeraX-CrystalContacts: 1.0.1 ChimeraX-DataFormats: 1.2.3 ChimeraX-Dicom: 1.2 ChimeraX-DistMonitor: 1.4.2 ChimeraX-DockPrep: 1.1.3 ChimeraX-Dssp: 2.0 ChimeraX-EMDB-SFF: 1.0 ChimeraX-ESMFold: 1.0 ChimeraX-FileHistory: 1.0.1 ChimeraX-FunctionKey: 1.0.1 ChimeraX-Geometry: 1.3 ChimeraX-gltf: 1.0 ChimeraX-Graphics: 1.1.1 ChimeraX-Hbonds: 2.4 ChimeraX-Help: 1.2.2 ChimeraX-HKCage: 1.3 ChimeraX-IHM: 1.1 ChimeraX-ImageFormats: 1.2 ChimeraX-IMOD: 1.0 ChimeraX-IO: 1.0.1 ChimeraX-ItemsInspection: 1.0.1 ChimeraX-IUPAC: 1.0 ChimeraX-Label: 1.1.9 ChimeraX-ListInfo: 1.2.2 ChimeraX-Log: 1.1.6 ChimeraX-LookingGlass: 1.1 ChimeraX-Maestro: 1.9.1 ChimeraX-Map: 1.1.4 ChimeraX-MapData: 2.0 ChimeraX-MapEraser: 1.0.1 ChimeraX-MapFilter: 2.0.1 ChimeraX-MapFit: 2.0 ChimeraX-MapSeries: 2.1.1 ChimeraX-Markers: 1.0.1 ChimeraX-Mask: 1.0.2 ChimeraX-MatchMaker: 2.1.3 ChimeraX-MCopy: 1.0 ChimeraX-MDcrds: 2.7 ChimeraX-MedicalToolbar: 1.0.2 ChimeraX-Meeting: 1.0.1 ChimeraX-MLP: 1.1.1 ChimeraX-mmCIF: 2.13 ChimeraX-MMTF: 2.2 ChimeraX-Modeller: 1.5.15 ChimeraX-ModelPanel: 1.5 ChimeraX-ModelSeries: 1.0.1 ChimeraX-Mol2: 2.0.3 ChimeraX-Mole: 1.0 ChimeraX-Morph: 1.0.2 ChimeraX-MouseModes: 1.2 ChimeraX-Movie: 1.0 ChimeraX-Neuron: 1.0 ChimeraX-Nifti: 1.1 ChimeraX-NMRSTAR: 1.0.2 ChimeraX-NRRD: 1.1 ChimeraX-Nucleotides: 2.0.3 ChimeraX-OpenCommand: 1.13.3 ChimeraX-PDB: 2.7.5 ChimeraX-PDBBio: 1.0.1 ChimeraX-PDBLibrary: 1.0.4 ChimeraX-PDBMatrices: 1.0 ChimeraX-PickBlobs: 1.0.1 ChimeraX-Positions: 1.0 ChimeraX-PresetMgr: 1.1.1 ChimeraX-PubChem: 2.1 ChimeraX-ReadPbonds: 1.0.1 ChimeraX-Registration: 1.1.2 ChimeraX-RemoteControl: 1.0 ChimeraX-RenderByAttr: 1.3 ChimeraX-RenumberResidues: 1.1 ChimeraX-ResidueFit: 1.0.1 ChimeraX-RestServer: 1.2 ChimeraX-RNALayout: 1.0 ChimeraX-RotamerLibMgr: 4.0 ChimeraX-RotamerLibsDunbrack: 2.0 ChimeraX-RotamerLibsDynameomics: 2.0 ChimeraX-RotamerLibsRichardson: 2.0 ChimeraX-SaveCommand: 1.5.1 ChimeraX-SchemeMgr: 1.0 ChimeraX-SDF: 2.0.2 ChimeraX-Segger: 1.0 ChimeraX-Segment: 1.0.1 ChimeraX-Segmentations: 1.0 ChimeraX-SelInspector: 1.0 ChimeraX-SeqView: 2.11.2 ChimeraX-Shape: 1.0.1 ChimeraX-Shell: 1.0.1 ChimeraX-Shortcuts: 1.1.1 ChimeraX-ShowSequences: 1.0.3 ChimeraX-SideView: 1.0.1 ChimeraX-Smiles: 2.1.2 ChimeraX-SmoothLines: 1.0 ChimeraX-SpaceNavigator: 1.0 ChimeraX-StdCommands: 1.16.3 ChimeraX-STL: 1.0.1 ChimeraX-Storm: 1.0 ChimeraX-StructMeasure: 1.2 ChimeraX-Struts: 1.0.1 ChimeraX-Surface: 1.0.1 ChimeraX-SwapAA: 2.0.1 ChimeraX-SwapRes: 2.5 ChimeraX-TapeMeasure: 1.0 ChimeraX-TaskManager: 1.0 ChimeraX-Test: 1.0 ChimeraX-Toolbar: 1.1.2 ChimeraX-ToolshedUtils: 1.2.4 ChimeraX-Topography: 1.0 ChimeraX-ToQuest: 1.0 ChimeraX-Tug: 1.0.1 ChimeraX-UI: 1.37.1 ChimeraX-uniprot: 2.3 ChimeraX-UnitCell: 1.0.1 ChimeraX-ViewDockX: 1.3.2 ChimeraX-VIPERdb: 1.0 ChimeraX-Vive: 1.1 ChimeraX-VolumeMenu: 1.0.1 ChimeraX-vrml: 1.0 ChimeraX-VTK: 1.0 ChimeraX-WavefrontOBJ: 1.0 ChimeraX-WebCam: 1.0.2 ChimeraX-WebServices: 1.1.3 ChimeraX-Zone: 1.0.1 colorama: 0.4.6 comm: 0.2.2 comtypes: 1.3.1 contourpy: 1.2.0 cxservices: 1.2.2 cycler: 0.12.1 Cython: 3.0.9 debugpy: 1.8.1 decorator: 5.1.1 docutils: 0.20.1 executing: 2.0.1 filelock: 3.13.1 fonttools: 4.50.0 funcparserlib: 2.0.0a0 glfw: 2.7.0 grako: 3.16.5 h5py: 3.10.0 html2text: 2024.2.26 idna: 3.6 ihm: 0.43 imagecodecs: 2024.1.1 imagesize: 1.4.1 ipykernel: 6.29.2 ipython: 8.21.0 ipywidgets: 8.1.2 jedi: 0.19.1 Jinja2: 3.1.3 jupyter-client: 8.6.0 jupyter-core: 5.7.2 jupyterlab-widgets: 3.0.10 kiwisolver: 1.4.5 line-profiler: 4.1.2 lxml: 5.1.0 lz4: 4.3.3 MarkupSafe: 2.1.5 matplotlib: 3.8.3 matplotlib-inline: 0.1.6 msgpack: 1.0.8 ndindex: 1.8 nest-asyncio: 1.6.0 netCDF4: 1.6.5 networkx: 3.2.1 nibabel: 5.0.1 nptyping: 2.5.0 numexpr: 2.9.0 numpy: 1.26.4 openvr: 1.26.701 packaging: 24.0 ParmEd: 4.2.2 parso: 0.8.3 pep517: 0.13.1 pillow: 10.2.0 pip: 24.0 pkginfo: 1.10.0 platformdirs: 4.2.0 prompt-toolkit: 3.0.43 psutil: 5.9.8 pure-eval: 0.2.2 py-cpuinfo: 9.0.0 pycollada: 0.8 pydicom: 2.3.0 pygments: 2.17.2 pynmrstar: 3.3.4 pynrrd: 1.0.0 PyOpenGL: 3.1.7 PyOpenGL-accelerate: 3.1.7 pyopenxr: 1.0.3302 pyparsing: 3.1.2 pyproject-hooks: 1.0.0 PyQt6-commercial: 6.6.1 PyQt6-Qt6: 6.6.2 PyQt6-sip: 13.6.0 PyQt6-WebEngine-commercial: 6.6.0 PyQt6-WebEngine-Qt6: 6.6.2 python-dateutil: 2.9.0.post0 pytz: 2024.1 pywin32: 306 pyzmq: 25.1.2 qtconsole: 5.5.1 QtPy: 2.4.1 RandomWords: 0.4.0 requests: 2.31.0 scipy: 1.12.0 setuptools: 69.2.0 sfftk-rw: 0.8.1 six: 1.16.0 snowballstemmer: 2.2.0 sortedcontainers: 2.4.0 soupsieve: 2.5 sphinx: 7.2.6 sphinx-autodoc-typehints: 2.0.0 sphinxcontrib-applehelp: 1.0.8 sphinxcontrib-blockdiag: 3.0.0 sphinxcontrib-devhelp: 1.0.6 sphinxcontrib-htmlhelp: 2.0.5 sphinxcontrib-jsmath: 1.0.1 sphinxcontrib-qthelp: 1.0.7 sphinxcontrib-serializinghtml: 1.1.10 stack-data: 0.6.3 superqt: 0.6.1 tables: 3.9.2 tcia-utils: 1.5.1 tifffile: 2024.1.30 tinyarray: 1.2.4 tornado: 6.4 traitlets: 5.14.1 typing-extensions: 4.10.0 tzdata: 2024.1 urllib3: 2.2.1 wcwidth: 0.2.13 webcolors: 1.13 wheel: 0.43.0 wheel-filename: 1.4.1 widgetsnbextension: 4.0.10 WMI: 1.5.1
Change History (2)
comment:1 by , 19 months ago
Cc: | added |
---|---|
Component: | Unassigned → Core |
Owner: | set to |
Platform: | → all |
Project: | → ChimeraX |
Status: | new → accepted |
Summary: | ChimeraX bug report submission → Crash in python_instances_of_class |
comment:2 by , 19 months ago
Resolution: | → duplicate |
---|---|
Status: | accepted → closed |
Note:
See TracTickets
for help on using tickets.