Opened 22 months ago
Closed 22 months ago
#10358 closed defect (fixed)
read_json_pae_matrix: KeyError: 0
Reported by: | Owned by: | Tom Goddard | |
---|---|---|---|
Priority: | normal | Milestone: | |
Component: | Structure Prediction | Version: | |
Keywords: | Cc: | ||
Blocked By: | Blocking: | ||
Notify when closed: | Platform: | all | |
Project: | ChimeraX |
Description
The following bug report has been submitted: Platform: Windows-10-10.0.19045 ChimeraX Version: 1.4.dev202204010229 (2022-04-01 02:29:39 UTC) Description (Describe the actions that caused this problem to occur here) Log: UCSF ChimeraX version: 1.4.dev202204010229 (2022-04-01) © 2016-2022 Regents of the University of California. All rights reserved. How to cite UCSF ChimeraX > open C:/Users/nabo0034/Downloads/SeMakC_0014-01_deposition_xyz.cif Summary of feedback from opening C:/Users/nabo0034/Downloads/SeMakC_0014-01_deposition_xyz.cif --- warnings | Atom H is not in the residue template for MET /B:1 Atom H3 is not in the residue template for GLN /B:108 Skipping chem_comp category: Missing column 'type' near line 2538 Skipping chem_comp category: Missing column 'type' near line 2678 Skipping chem_comp category: Missing column 'type' near line 2840 Skipping chem_comp category: Missing column 'type' near line 2977 Skipping chem_comp category: Missing column 'type' near line 3112 15 messages similar to the above omitted Chain information for SeMakC_0014-01_deposition_xyz.cif #1 --- Chain | Description B | No description available > select /B 2041 atoms, 2026 bonds, 2 pseudobonds, 134 residues, 2 models selected > hide sel atoms > select clear > select ::name="HOH" 110 atoms, 110 residues, 1 model selected > hide sel atoms > rainbow sel [Repeated 1 time(s)] > select /B 2041 atoms, 2026 bonds, 2 pseudobonds, 134 residues, 2 models selected > rainbow sel > ui tool show "Show Sequence Viewer" > sequence chain /B Alignment identifier is 1/B > select /B:1 19 atoms, 18 bonds, 1 residue, 1 model selected > select /B:1-71 1087 atoms, 1091 bonds, 71 residues, 1 model selected > select /B:12-18,22-24,41-43,75-78 231 atoms, 227 bonds, 17 residues, 1 model selected > select /B:4-10,25-29,34-36,45-49,53-60,67-73,85-89,92-98 769 atoms, 768 bonds, 47 residues, 1 model selected > show sel atoms > hide sel atoms > show sel atoms [Repeated 1 time(s)] > hide sel atoms > select clear > ui tool show "Command Line Interface" > set bgColor white > select /B:1 19 atoms, 18 bonds, 1 residue, 1 model selected > select /B:1-73 1121 atoms, 1126 bonds, 73 residues, 1 model selected > ui tool show "Show Sequence Viewer" > sequence chain /B Destroying pre-existing alignment with identifier 1/B Alignment identifier is 1/B > close session > ui tool show AlphaFold > alphafold predict > MKKIEILIVVDCAGALATTSLISNVYLIDSNQWLGSWDEGTCQLHTVSEDGQFICWRSCAISPDDEVNITGFYGDMIDQKACLPSPVNDAWEGRVQTRGDTGRYLYTISLSINGITMNFSPYLEVQ,MKKVEILMVVDAAAALASRDLQSNIYLIDTNKYMGSGNEGQAELKTACKDGQLLCWRVVAISPDNEVDIVEFNGQMINDRVCIPTKQGLSGDEFWEGRVEAQGQASTQQYNATLSIDGSRLTFDPFLVISL Running AlphaFold prediction [Repeated 2 time(s)]AlphaFold prediction finished Results in C:\Users\nabo0034/Downloads\ChimeraX\AlphaFold\prediction_1 Chain information for best_model.pdb #1 --- Chain | Description A | No description available B | No description available > ui tool show "AlphaFold Error Plot" > alphafold pae #1 file > C:\\\Users\\\nabo0034/Downloads\\\ChimeraX\\\AlphaFold\\\prediction_1\\\best_model_pae.json Traceback (most recent call last): File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\alphafold\pae.py", line 158, in _open_pae self._open_pae_from_file(s) File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\alphafold\pae.py", line 182, in _open_pae_from_file run(self.session, cmd) File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\core\commands\run.py", line 38, in run results = command.run(text, log=log, return_json=return_json) File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\core\commands\cli.py", line 2897, in run result = ci.function(session, **kw_args) File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\alphafold\pae.py", line 674, in alphafold_pae pae = AlphaFoldPAE(file, structure) File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\alphafold\pae.py", line 477, in __init__ self._pae_matrix = read_pae_matrix(pae_path) File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\alphafold\pae.py", line 531, in read_pae_matrix return read_json_pae_matrix(path) File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\alphafold\pae.py", line 546, in read_json_pae_matrix d = j[0] KeyError: 0 KeyError: 0 File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\alphafold\pae.py", line 546, in read_json_pae_matrix d = j[0] See log for complete Python traceback. > alphafold pae #1 file > C:\\\Users\\\nabo0034/Downloads\\\ChimeraX\\\AlphaFold\\\prediction_1\\\best_model_pae.json Traceback (most recent call last): File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\alphafold\pae.py", line 158, in _open_pae self._open_pae_from_file(s) File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\alphafold\pae.py", line 182, in _open_pae_from_file run(self.session, cmd) File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\core\commands\run.py", line 38, in run results = command.run(text, log=log, return_json=return_json) File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\core\commands\cli.py", line 2897, in run result = ci.function(session, **kw_args) File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\alphafold\pae.py", line 674, in alphafold_pae pae = AlphaFoldPAE(file, structure) File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\alphafold\pae.py", line 477, in __init__ self._pae_matrix = read_pae_matrix(pae_path) File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\alphafold\pae.py", line 531, in read_pae_matrix return read_json_pae_matrix(path) File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\alphafold\pae.py", line 546, in read_json_pae_matrix d = j[0] KeyError: 0 KeyError: 0 File "C:\Program Files\ChimeraX 1.4.dev202204010229\bin\lib\site- packages\chimerax\alphafold\pae.py", line 546, in read_json_pae_matrix d = j[0] See log for complete Python traceback. OpenGL version: 3.3.0 - Build 27.20.100.9664 OpenGL renderer: Intel(R) HD Graphics 630 OpenGL vendor: Intel Python: 3.9.11 Locale: sv_SE.cp1252 Qt version: PyQt6 6.2.3, Qt 6.2.3 Qt platform: windows Manufacturer: Dell Inc. Model: OptiPlex 7050 OS: Microsoft Windows 10 Enterprise (Build 19045) Memory: 17,036,312,576 MaxProcessMemory: 137,438,953,344 CPU: 8 Intel(R) Core(TM) i7-7700 CPU @ 3.60GHz OSLanguage: en-US Installed Packages: alabaster: 0.7.12 appdirs: 1.4.4 Babel: 2.9.1 backcall: 0.2.0 blockdiag: 3.0.0 certifi: 2021.10.8 cftime: 1.6.0 charset-normalizer: 2.0.12 ChimeraX-AddCharge: 1.2.3 ChimeraX-AddH: 2.1.11 ChimeraX-AlignmentAlgorithms: 2.0 ChimeraX-AlignmentHdrs: 3.2.1 ChimeraX-AlignmentMatrices: 2.0 ChimeraX-Alignments: 2.4 ChimeraX-AlphaFold: 1.0 ChimeraX-AltlocExplorer: 1.0.2 ChimeraX-AmberInfo: 1.0 ChimeraX-Arrays: 1.0 ChimeraX-Atomic: 1.37 ChimeraX-AtomicLibrary: 6.1.2 ChimeraX-AtomSearch: 2.0.1 ChimeraX-AxesPlanes: 2.1 ChimeraX-BasicActions: 1.1 ChimeraX-BILD: 1.0 ChimeraX-BlastProtein: 2.0 ChimeraX-BondRot: 2.0 ChimeraX-BugReporter: 1.0 ChimeraX-BuildStructure: 2.6.1 ChimeraX-Bumps: 1.0 ChimeraX-BundleBuilder: 1.1 ChimeraX-ButtonPanel: 1.0 ChimeraX-CageBuilder: 1.0 ChimeraX-CellPack: 1.0 ChimeraX-Centroids: 1.2 ChimeraX-ChemGroup: 2.0 ChimeraX-Clashes: 2.2.2 ChimeraX-ColorActions: 1.0 ChimeraX-ColorGlobe: 1.0 ChimeraX-ColorKey: 1.5.1 ChimeraX-CommandLine: 1.2.3 ChimeraX-ConnectStructure: 2.0.1 ChimeraX-Contacts: 1.0 ChimeraX-Core: 1.4.dev202204010229 ChimeraX-CoreFormats: 1.1 ChimeraX-coulombic: 1.3.2 ChimeraX-Crosslinks: 1.0 ChimeraX-Crystal: 1.0 ChimeraX-CrystalContacts: 1.0 ChimeraX-DataFormats: 1.2.2 ChimeraX-Dicom: 1.0 ChimeraX-DistMonitor: 1.1.5 ChimeraX-Dssp: 2.0 ChimeraX-EMDB-SFF: 1.0 ChimeraX-ExperimentalCommands: 1.0 ChimeraX-FileHistory: 1.0 ChimeraX-FunctionKey: 1.0 ChimeraX-Geometry: 1.1 ChimeraX-gltf: 1.0 ChimeraX-Graphics: 1.1 ChimeraX-Hbonds: 2.1.2 ChimeraX-Help: 1.2 ChimeraX-HKCage: 1.3 ChimeraX-IHM: 1.1 ChimeraX-ImageFormats: 1.2 ChimeraX-IMOD: 1.0 ChimeraX-IO: 1.0.1 ChimeraX-ItemsInspection: 1.0 ChimeraX-Label: 1.1 ChimeraX-ListInfo: 1.1.1 ChimeraX-Log: 1.1.5 ChimeraX-LookingGlass: 1.1 ChimeraX-Maestro: 1.8.1 ChimeraX-Map: 1.1 ChimeraX-MapData: 2.0 ChimeraX-MapEraser: 1.0 ChimeraX-MapFilter: 2.0 ChimeraX-MapFit: 2.0 ChimeraX-MapSeries: 2.1 ChimeraX-Markers: 1.0 ChimeraX-Mask: 1.0 ChimeraX-MatchMaker: 2.0.6 ChimeraX-MDcrds: 2.6 ChimeraX-MedicalToolbar: 1.0.1 ChimeraX-Meeting: 1.0 ChimeraX-MLP: 1.1 ChimeraX-mmCIF: 2.7 ChimeraX-MMTF: 2.1 ChimeraX-Modeller: 1.5.5 ChimeraX-ModelPanel: 1.3.2 ChimeraX-ModelSeries: 1.0 ChimeraX-Mol2: 2.0 ChimeraX-Morph: 1.0 ChimeraX-MouseModes: 1.1 ChimeraX-Movie: 1.0 ChimeraX-Neuron: 1.0 ChimeraX-Nucleotides: 2.0.2 ChimeraX-OpenCommand: 1.8 ChimeraX-PDB: 2.6.6 ChimeraX-PDBBio: 1.0 ChimeraX-PDBLibrary: 1.0.2 ChimeraX-PDBMatrices: 1.0 ChimeraX-PickBlobs: 1.0 ChimeraX-Positions: 1.0 ChimeraX-PresetMgr: 1.1 ChimeraX-PubChem: 2.1 ChimeraX-ReadPbonds: 1.0.1 ChimeraX-Registration: 1.1 ChimeraX-RemoteControl: 1.0 ChimeraX-ResidueFit: 1.0 ChimeraX-RestServer: 1.1 ChimeraX-RNALayout: 1.0 ChimeraX-RotamerLibMgr: 2.0.1 ChimeraX-RotamerLibsDunbrack: 2.0 ChimeraX-RotamerLibsDynameomics: 2.0 ChimeraX-RotamerLibsRichardson: 2.0 ChimeraX-SaveCommand: 1.5 ChimeraX-SchemeMgr: 1.0 ChimeraX-SDF: 2.0 ChimeraX-Segger: 1.0 ChimeraX-Segment: 1.0 ChimeraX-SelInspector: 1.0 ChimeraX-SeqView: 2.6 ChimeraX-Shape: 1.0.1 ChimeraX-Shell: 1.0 ChimeraX-Shortcuts: 1.1 ChimeraX-ShowAttr: 1.0 ChimeraX-ShowSequences: 1.0 ChimeraX-SideView: 1.0 ChimeraX-Smiles: 2.1 ChimeraX-SmoothLines: 1.0 ChimeraX-SpaceNavigator: 1.0 ChimeraX-StdCommands: 1.8 ChimeraX-STL: 1.0 ChimeraX-Storm: 1.0 ChimeraX-StructMeasure: 1.0.1 ChimeraX-Struts: 1.0.1 ChimeraX-Surface: 1.0 ChimeraX-SwapAA: 2.0 ChimeraX-SwapRes: 2.1.1 ChimeraX-TapeMeasure: 1.0 ChimeraX-Test: 1.0 ChimeraX-Toolbar: 1.1 ChimeraX-ToolshedUtils: 1.2.1 ChimeraX-Tug: 1.0 ChimeraX-UI: 1.16.4 ChimeraX-uniprot: 2.2 ChimeraX-UnitCell: 1.0 ChimeraX-ViewDockX: 1.1.2 ChimeraX-VIPERdb: 1.0 ChimeraX-Vive: 1.1 ChimeraX-VolumeMenu: 1.0 ChimeraX-VTK: 1.0 ChimeraX-WavefrontOBJ: 1.0 ChimeraX-WebCam: 1.0 ChimeraX-WebServices: 1.0 ChimeraX-Zone: 1.0 colorama: 0.4.4 comtypes: 1.1.10 cxservices: 1.1 cycler: 0.11.0 Cython: 0.29.26 debugpy: 1.6.0 decorator: 5.1.1 docutils: 0.17.1 entrypoints: 0.4 filelock: 3.4.2 fonttools: 4.31.2 funcparserlib: 1.0.0a0 grako: 3.16.5 h5py: 3.6.0 html2text: 2020.1.16 idna: 3.3 ihm: 0.27 imagecodecs: 2021.11.20 imagesize: 1.3.0 ipykernel: 6.6.1 ipython: 7.31.1 ipython-genutils: 0.2.0 jedi: 0.18.1 Jinja2: 3.0.3 jupyter-client: 7.1.0 jupyter-core: 4.9.2 kiwisolver: 1.4.2 line-profiler: 3.4.0 lxml: 4.7.1 lz4: 3.1.10 MarkupSafe: 2.1.1 matplotlib: 3.5.1 matplotlib-inline: 0.1.3 msgpack: 1.0.3 nest-asyncio: 1.5.5 netCDF4: 1.5.8 networkx: 2.6.3 numexpr: 2.8.1 numpy: 1.22.1 openvr: 1.16.802 packaging: 21.3 ParmEd: 3.4.3 parso: 0.8.3 pickleshare: 0.7.5 Pillow: 9.0.1 pip: 21.3.1 pkginfo: 1.8.2 prompt-toolkit: 3.0.28 psutil: 5.9.0 pycollada: 0.7.2 pydicom: 2.2.2 Pygments: 2.11.2 PyOpenGL: 3.1.5 PyOpenGL-accelerate: 3.1.5 pyparsing: 3.0.7 PyQt6-commercial: 6.2.3 PyQt6-sip: 13.2.0 PyQt6-WebEngine-commercial: 6.2.1 python-dateutil: 2.8.2 pytz: 2022.1 pywin32: 303 pyzmq: 22.3.0 qtconsole: 5.3.0 QtPy: 2.0.1 RandomWords: 0.3.0 requests: 2.27.1 scipy: 1.7.3 setuptools: 59.8.0 sfftk-rw: 0.7.1 six: 1.16.0 snowballstemmer: 2.2.0 sortedcontainers: 2.4.0 Sphinx: 4.3.2 sphinx-autodoc-typehints: 1.15.2 sphinxcontrib-applehelp: 1.0.2 sphinxcontrib-blockdiag: 3.0.0 sphinxcontrib-devhelp: 1.0.2 sphinxcontrib-htmlhelp: 2.0.0 sphinxcontrib-jsmath: 1.0.1 sphinxcontrib-qthelp: 1.0.3 sphinxcontrib-serializinghtml: 1.1.5 suds-community: 1.0.0 tables: 3.7.0 tifffile: 2021.11.2 tinyarray: 1.2.4 tornado: 6.1 traitlets: 5.1.1 urllib3: 1.26.9 wcwidth: 0.2.5 webcolors: 1.11.1 wheel: 0.37.1 wheel-filename: 1.3.0 WMI: 1.5.1
Change History (2)
comment:1 by , 22 months ago
Component: | Unassigned → Structure Prediction |
---|---|
Owner: | set to |
Platform: | → all |
Project: | → ChimeraX |
Status: | new → assigned |
Summary: | ChimeraX bug report submission → read_json_pae_matrix: KeyError: 0 |
comment:2 by , 22 months ago
Resolution: | → fixed |
---|---|
Status: | assigned → closed |
Note:
See TracTickets
for help on using tickets.
This ChimeraX error parsing AlphaFold PAE results is from using an old pre-release ChimeraX 1.4 version. The PAE file produced by Colabfold changed format after that ChimeraX release, so you need to use a newer ChimeraX. Get the ChimeraX 1.6 release or 1.7 release candidate.