Opened 3 years ago
Closed 3 years ago
#10244 closed defect (fixed)
"Direct" modeling doesn't handle target deletion relative to template
| Reported by: | Eric Pettersen | Owned by: | Eric Pettersen |
|---|---|---|---|
| Priority: | normal | Milestone: | |
| Component: | Structure Prediction | Version: | |
| Keywords: | Cc: | Elaine Meng | |
| Blocked By: | Blocking: | ||
| Notify when closed: | Platform: | all | |
| Project: | ChimeraX |
Description
The following bug report has been submitted:
Platform: macOS-12.7.1-x86_64-i386-64bit
ChimeraX Version: 1.7.dev202311080002 (2023-11-08 00:02:18 UTC)
Description
If the template is directly assocated with target, then modeling fails where the target has a deletion relative to the sequence.
Log:
UCSF ChimeraX version: 1.7.dev202311080002 (2023-11-08)
© 2016-2023 Regents of the University of California. All rights reserved.
How to cite UCSF ChimeraX
> open /Users/pett/rm/alignment.ali
Summary of feedback from opening /Users/pett/rm/alignment.ali
---
note | Alignment identifier is alignment.ali
Opened 1 sequences from alignment.ali
> open /Users/pett/rm/EOGG2KP8FQQJNC4G/2Q7Y_clean_format.pdb_1.pdb
Chain information for 2Q7Y_clean_format.pdb_1.pdb #1
---
Chain | Description
C | No description available
D | No description available
> sequence associate /C
Associated 2Q7Y_clean_format.pdb_1.pdb chain C to chain_C with 87 mismatches
and/or gaps
> ui tool show "Modeller Comparative"
> modeller comparative alignment.ali:1 numModels 3 fast false multichain true
> hetPreserve false hydrogens false waterPreserve false directory
> /Users/pett/rm
Webservices job id: GCVVGQW9762J1460
Modeller job (ID GCVVGQW9762J1460) finished
Modeller error output
Traceback (most recent call last):
File "ModellerModelling.py", line 72, in <module>
a.make()
File "/usr/lib64/python3.8/site-packages/modeller/automodel/automodel.py",
line 141, in make
self.homcsr(exit_stage)
File "/usr/lib64/python3.8/site-packages/modeller/automodel/automodel.py",
line 625, in homcsr
self.check_alignment(aln)
File "/usr/lib64/python3.8/site-packages/modeller/automodel/automodel.py",
line 578, in check_alignment
aln.check()
File "/usr/lib64/python3.8/site-packages/modeller/alignment.py", line 213, in
check
self.check_structure_structure(io=io)
File "/usr/lib64/python3.8/site-packages/modeller/alignment.py", line 222, in
check_structure_structure
return f(self.modpt, io.modpt, self.env.libs.modpt, eqvdst)
_modeller.SequenceMismatchError: read_te_291E> Sequence difference between
alignment and pdb :
Modeller run output
MODELLER 10.4, 2022/10/28, r12463
PROTEIN STRUCTURE MODELLING BY SATISFACTION OF SPATIAL RESTRAINTS
Copyright(c) 1989-2022 Andrej Sali
All Rights Reserved
Written by A. Sali
with help from
B. Webb, M.S. Madhusudhan, M-Y. Shen, G.Q. Dong,
M.A. Marti-Renom, N. Eswar, F. Alber, M. Topf, B. Oliva,
A. Fiser, R. Sanchez, B. Yerkovich, A. Badretdinov,
F. Melo, J.P. Overington, E. Feyfant
University of California, San Francisco, USA
Rockefeller University, New York, USA
Harvard University, Cambridge, USA
Imperial Cancer Research Fund, London, UK
Birkbeck College, University of London, London, UK
Kind, OS, HostName, Kernel, Processor: 4, Linux wilkins.cgl.ucsf.edu
4.18.0-477.21.1.el8_8.x86_64 x86_64
Date and time of compilation : 2022/10/28 21:02:55
MODELLER executable type : x86_64-intel8
Job starting time (YY/MM/DD HH:MM:SS): 2023/11/28 11:24:13
environ____W> The class 'environ' is deprecated; use 'Environ' instead
openf___224_> Open $(LIB)/restyp.lib
openf___224_> Open ${MODINSTALL10v4}/modlib/resgrp.lib
rdresgr_266_> Number of residue groups: 2
openf___224_> Open ${MODINSTALL10v4}/modlib/sstruc.lib
Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 191566 187.076
0.183
Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 192094 187.592
0.183
openf___224_> Open ${MODINSTALL10v4}/modlib/resdih.lib
Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 240694 235.053
0.230
rdrdih__263_> Number of dihedral angle types : 9
Maximal number of dihedral angle optima: 3
Dihedral angle names : Alph Phi Psi Omeg chi1 chi2 chi3 chi4 chi5
openf___224_> Open ${MODINSTALL10v4}/modlib/radii.lib
Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 253994 248.041
0.242
openf___224_> Open ${MODINSTALL10v4}/modlib/af_mnchdef.lib
rdwilmo_274_> Mainchain residue conformation classes: APBLE
openf___224_> Open ${MODINSTALL10v4}/modlib/mnch.lib
rdclass_257_> Number of classes: 5
openf___224_> Open ${MODINSTALL10v4}/modlib/mnch1.lib
openf___224_> Open ${MODINSTALL10v4}/modlib/mnch2.lib
openf___224_> Open ${MODINSTALL10v4}/modlib/mnch3.lib
openf___224_> Open ${MODINSTALL10v4}/modlib/xs4.mat
rdrrwgh_268_> Number of residue types: 21
automodel__W> The class 'automodel' is deprecated; use 'AutoModel' instead
openf___224_> Open alignment.ali
Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 282425 275.806
0.269
Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 297517 290.544
0.284
Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 312917 305.583
0.298
Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 343717 335.661
0.328
Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 405317 395.817
0.387
Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 405345 395.845 0.387
Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 405373 395.872 0.387
Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 406829 397.294 0.388
Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 407913 398.353 0.389
Read the alignment from file : alignment.ali
Total number of alignment positions: 370
# Code #_Res #_Segm PDB_code Name
\-------------------------------------------------------------------------------
1 2Q7Y_clea 365 2 2Q7Y_clean_
2 chain_C 272 1 chain_C
check_a_343_> >> BEGINNING OF COMMAND
openf___224_> Open ./2Q7Y_clean_format.pdb_1.pdb_1.pdb
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 519138 506.971
0.495
Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 519138 506.971 0.495
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 519309 507.138
0.495
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 520159 507.968
0.496
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 521417 509.196
0.497
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 523321 511.056
0.499
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 526177 513.845
0.502
Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 526177 513.845 0.502
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 526267 513.933
0.502
Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 526267 513.933 0.502
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 526402 514.064
0.502
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 530686 518.248
0.506
Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 530686 518.248 0.506
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 530884 518.441
0.506
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 537310 524.717
0.512
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 546932 534.113
0.522
Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 546932 534.113 0.522
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 547229 534.403
0.522
Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 547229 534.403 0.522
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 547679 534.843
0.522
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 562129 548.954
0.536
Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 562129 548.954 0.536
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 562804 549.613
0.537
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 584462 570.764
0.557
Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 584462 570.764 0.557
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 584462 570.764
0.557
Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 584462 570.764 0.557
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 585470 571.748
0.558
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 617974 603.490
0.589
Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 617974 603.490 0.589
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 619486 604.967
0.591
Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 668242 652.580
0.637
Dynamically allocated memory at amaxstructure [B,KiB,MiB]: 667608 651.961
0.637
read_te_291E> Sequence difference between alignment and pdb :
x (mismatch at alignment position 82)
Alignment ELVKMPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLD
PDB ELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSW
Match ***** * *
Alignment residue type 13 (P, PRO) does not match pdb
residue type 11 (M, MET),
for align code 2Q7Y_clean_format.pdb_1.pdb_1 (atom file
2Q7Y_clean_format.pdb_1.pdb_1), pdb residue number " 88", chain "C"
Please check your alignment file header to be sure you correctly specified
the starting and ending residue numbers and chains. The alignment sequence
must match that from the atom file exactly.
Another possibility is that some residues in the atom file are missing,
perhaps because they could not be resolved experimentally. (Note that Modeller
reads only the ATOM and HETATM records in PDB, NOT the SEQRES records.)
In this case, simply replace the section of your alignment corresponding
to these missing residues with gaps.
read_te_288W> Protein not accepted: 1 2Q7Y_clean_format.pdb_1.pdb_1
No output models from Modeller; see log for Modeller text output.
Traceback (most recent call last):
File
"/Users/pett/src/chimerax/ChimeraX.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/ui/gui.py", line 717, in customEvent
func(*args, **kw)
File
"/Users/pett/src/chimerax/ChimeraX.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/modeller/common.py", line 602, in on_finish
self.caller.process_ok_models(model_info, get_pdb_model)
^^^^^^^^^^
UnboundLocalError: cannot access local variable 'model_info' where it is not
associated with a value
UnboundLocalError: cannot access local variable 'model_info' where it is not
associated with a value
File
"/Users/pett/src/chimerax/ChimeraX.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site-
packages/chimerax/modeller/common.py", line 602, in on_finish
self.caller.process_ok_models(model_info, get_pdb_model)
^^^^^^^^^^
See log for complete Python traceback.
OpenGL version: 4.1 INTEL-18.8.6
OpenGL renderer: Intel(R) Iris(TM) Pro Graphics 6200
OpenGL vendor: Intel Inc.
Python: 3.11.2
Locale: en_US.UTF-8
Qt version: PyQt6 6.4.2, Qt 6.4.2
Qt runtime version: 6.4.3
Qt platform: cocoa
Hardware:
Hardware Overview:
Model Name: iMac
Model Identifier: iMac16,2
Processor Name: Quad-Core Intel Core i5
Processor Speed: 2.8 GHz
Number of Processors: 1
Total Number of Cores: 4
L2 Cache (per Core): 256 KB
L3 Cache: 4 MB
Memory: 16 GB
System Firmware Version: 486.0.0.0.0
OS Loader Version: 540.120.3~37
SMC Version (system): 2.32f21
Software:
System Software Overview:
System Version: macOS 12.7.1 (21G920)
Kernel Version: Darwin 21.6.0
Time since boot: 3:47
Graphics/Displays:
Intel Iris Pro Graphics 6200:
Chipset Model: Intel Iris Pro Graphics 6200
Type: GPU
Bus: Built-In
VRAM (Dynamic, Max): 1536 MB
Vendor: Intel
Device ID: 0x1622
Revision ID: 0x000a
Metal Family: Supported, Metal GPUFamily macOS 1
Displays:
iMac:
Display Type: LCD
Resolution: 1920 x 1080 (1080p FHD - Full High Definition)
UI Looks like: 1920 x 1080
Framebuffer Depth: 24-Bit Color (ARGB8888)
Main Display: Yes
Mirror: Off
Online: Yes
Automatically Adjust Brightness: Yes
Connection Type: Internal
Installed Packages:
alabaster: 0.7.13
appdirs: 1.4.4
appnope: 0.1.3
asttokens: 2.2.1
Babel: 2.12.1
backcall: 0.2.0
beautifulsoup4: 4.11.2
blockdiag: 3.0.0
blosc2: 2.0.0
build: 0.10.0
certifi: 2022.12.7
cftime: 1.6.2
charset-normalizer: 3.1.0
ChimeraX-AddCharge: 1.5.12
ChimeraX-AddH: 2.2.5
ChimeraX-AlignmentAlgorithms: 2.0.1
ChimeraX-AlignmentHdrs: 3.4.1
ChimeraX-AlignmentMatrices: 2.1
ChimeraX-Alignments: 2.12.1
ChimeraX-AlphaFold: 1.0
ChimeraX-AltlocExplorer: 1.1.1
ChimeraX-AmberInfo: 1.0
ChimeraX-Arrays: 1.1
ChimeraX-Atomic: 1.50
ChimeraX-AtomicLibrary: 12.1.2
ChimeraX-AtomSearch: 2.0.1
ChimeraX-AxesPlanes: 2.3.2
ChimeraX-BasicActions: 1.1.2
ChimeraX-BILD: 1.0
ChimeraX-BlastProtein: 2.1.2
ChimeraX-BondRot: 2.0.4
ChimeraX-BugReporter: 1.0.1
ChimeraX-BuildStructure: 2.10.5
ChimeraX-Bumps: 1.0
ChimeraX-BundleBuilder: 1.2.2
ChimeraX-ButtonPanel: 1.0.1
ChimeraX-CageBuilder: 1.0.1
ChimeraX-CellPack: 1.0
ChimeraX-Centroids: 1.3.2
ChimeraX-ChangeChains: 1.1
ChimeraX-CheckWaters: 1.3.1
ChimeraX-ChemGroup: 2.0.1
ChimeraX-Clashes: 2.2.4
ChimeraX-ColorActions: 1.0.3
ChimeraX-ColorGlobe: 1.0
ChimeraX-ColorKey: 1.5.5
ChimeraX-CommandLine: 1.2.5
ChimeraX-ConnectStructure: 2.0.1
ChimeraX-Contacts: 1.0.1
ChimeraX-Core: 1.7.dev202311080002
ChimeraX-CoreFormats: 1.2
ChimeraX-coulombic: 1.4.2
ChimeraX-Crosslinks: 1.0
ChimeraX-Crystal: 1.0
ChimeraX-CrystalContacts: 1.0.1
ChimeraX-DataFormats: 1.2.3
ChimeraX-Dicom: 1.2
ChimeraX-DistMonitor: 1.4
ChimeraX-DockPrep: 1.1.2
ChimeraX-Dssp: 2.0
ChimeraX-EMDB-SFF: 1.0
ChimeraX-ESMFold: 1.0
ChimeraX-FileHistory: 1.0.1
ChimeraX-FunctionKey: 1.0.1
ChimeraX-Geometry: 1.3
ChimeraX-gltf: 1.0
ChimeraX-Graphics: 1.1.1
ChimeraX-Hbonds: 2.4
ChimeraX-Help: 1.2.2
ChimeraX-HKCage: 1.3
ChimeraX-IHM: 1.1
ChimeraX-ImageFormats: 1.2
ChimeraX-IMOD: 1.0
ChimeraX-IO: 1.0.1
ChimeraX-ItemsInspection: 1.0.1
ChimeraX-IUPAC: 1.0
ChimeraX-Label: 1.1.8
ChimeraX-ListInfo: 1.2.1
ChimeraX-Log: 1.1.6
ChimeraX-LookingGlass: 1.1
ChimeraX-Maestro: 1.9.1
ChimeraX-Map: 1.1.4
ChimeraX-MapData: 2.0
ChimeraX-MapEraser: 1.0.1
ChimeraX-MapFilter: 2.0.1
ChimeraX-MapFit: 2.0
ChimeraX-MapSeries: 2.1.1
ChimeraX-Markers: 1.0.1
ChimeraX-Mask: 1.0.2
ChimeraX-MatchAlign: 1.0
ChimeraX-MatchMaker: 2.1.2
ChimeraX-MCopy: 1.0
ChimeraX-MDcrds: 2.6
ChimeraX-MedicalToolbar: 1.0.2
ChimeraX-Meeting: 1.0.1
ChimeraX-MLP: 1.1.1
ChimeraX-mmCIF: 2.12.1
ChimeraX-MMTF: 2.2
ChimeraX-Modeller: 1.5.12
ChimeraX-ModelPanel: 1.4
ChimeraX-ModelSeries: 1.0.1
ChimeraX-Mol2: 2.0.3
ChimeraX-Mole: 1.0
ChimeraX-Morph: 1.0.2
ChimeraX-MouseModes: 1.2
ChimeraX-Movie: 1.0
ChimeraX-Neuron: 1.0
ChimeraX-Nifti: 1.1
ChimeraX-NIHPresets: 1.1.14
ChimeraX-NRRD: 1.1
ChimeraX-Nucleotides: 2.0.3
ChimeraX-OpenCommand: 1.13
ChimeraX-PDB: 2.7.2
ChimeraX-PDBBio: 1.0.1
ChimeraX-PDBLibrary: 1.0.3
ChimeraX-PDBMatrices: 1.0
ChimeraX-PhenixUI: 1.2.1
ChimeraX-PickBlobs: 1.0.1
ChimeraX-Positions: 1.0
ChimeraX-PresetMgr: 1.1
ChimeraX-PubChem: 2.1
ChimeraX-ReadPbonds: 1.0.1
ChimeraX-Registration: 1.1.2
ChimeraX-RemoteControl: 1.0
ChimeraX-RenderByAttr: 1.2
ChimeraX-RenumberResidues: 1.1
ChimeraX-ResidueFit: 1.0.1
ChimeraX-RestServer: 1.2
ChimeraX-RNALayout: 1.0
ChimeraX-RotamerLibMgr: 4.0
ChimeraX-RotamerLibsDunbrack: 2.0
ChimeraX-RotamerLibsDynameomics: 2.0
ChimeraX-RotamerLibsRichardson: 2.0
ChimeraX-SaveCommand: 1.5.1
ChimeraX-SchemeMgr: 1.0
ChimeraX-SDF: 2.0.2
ChimeraX-Segger: 1.0
ChimeraX-Segment: 1.0.1
ChimeraX-SelInspector: 1.0
ChimeraX-SeqView: 2.11
ChimeraX-Shape: 1.0.1
ChimeraX-Shell: 1.0.1
ChimeraX-Shortcuts: 1.1.1
ChimeraX-ShowSequences: 1.0.2
ChimeraX-SideView: 1.0.1
ChimeraX-Smiles: 2.1.2
ChimeraX-SmoothLines: 1.0
ChimeraX-SpaceNavigator: 1.0
ChimeraX-StdCommands: 1.13
ChimeraX-STL: 1.0.1
ChimeraX-Storm: 1.0
ChimeraX-StructMeasure: 1.1.2
ChimeraX-Struts: 1.0.1
ChimeraX-Surface: 1.0.1
ChimeraX-SwapAA: 2.0.1
ChimeraX-SwapRes: 2.2.2
ChimeraX-TapeMeasure: 1.0
ChimeraX-TaskManager: 1.0
ChimeraX-Test: 1.0
ChimeraX-Toolbar: 1.1.2
ChimeraX-ToolshedUtils: 1.2.4
ChimeraX-Topography: 1.0
ChimeraX-ToQuest: 1.0
ChimeraX-Tug: 1.0.1
ChimeraX-UI: 1.33.3
ChimeraX-uniprot: 2.3
ChimeraX-UnitCell: 1.0.1
ChimeraX-ViewDockX: 1.3.2
ChimeraX-VIPERdb: 1.0
ChimeraX-Vive: 1.1
ChimeraX-VolumeMenu: 1.0.1
ChimeraX-VTK: 1.0
ChimeraX-WavefrontOBJ: 1.0
ChimeraX-WebCam: 1.0.2
ChimeraX-WebServices: 1.1.3
ChimeraX-Zone: 1.0.1
colorama: 0.4.6
comm: 0.1.3
contourpy: 1.1.0
cxservices: 1.2.2
cycler: 0.11.0
Cython: 0.29.33
debugpy: 1.6.7
decorator: 5.1.1
docutils: 0.19
executing: 1.2.0
filelock: 3.9.0
fonttools: 4.40.0
funcparserlib: 1.0.1
grako: 3.16.5
h5py: 3.9.0
html2text: 2020.1.16
idna: 3.4
ihm: 0.35
imagecodecs: 2023.3.16
imagesize: 1.4.1
ipykernel: 6.23.2
ipython: 8.14.0
ipython-genutils: 0.2.0
ipywidgets: 8.0.6
jedi: 0.18.2
Jinja2: 3.1.2
jupyter-client: 8.2.0
jupyter-core: 5.3.1
jupyterlab-widgets: 3.0.7
kiwisolver: 1.4.4
line-profiler: 4.0.2
lxml: 4.9.2
lz4: 4.3.2
MarkupSafe: 2.1.3
matplotlib: 3.6.3
matplotlib-inline: 0.1.6
msgpack: 1.0.4
nest-asyncio: 1.5.6
netCDF4: 1.6.2
networkx: 2.8.8
nibabel: 5.0.1
nptyping: 2.5.0
numexpr: 2.8.4
numpy: 1.23.5
openvr: 1.23.701
packaging: 21.3
ParmEd: 3.4.3
parso: 0.8.3
pep517: 0.13.0
pexpect: 4.8.0
pickleshare: 0.7.5
Pillow: 9.3.0
pip: 23.0
pkginfo: 1.9.6
platformdirs: 3.8.0
prompt-toolkit: 3.0.38
psutil: 5.9.4
ptyprocess: 0.7.0
pure-eval: 0.2.2
py-cpuinfo: 9.0.0
pycollada: 0.7.2
pydicom: 2.3.0
Pygments: 2.14.0
pynrrd: 1.0.0
PyOpenGL: 3.1.6
PyOpenGL-accelerate: 3.1.6
pyparsing: 3.1.0
pyproject-hooks: 1.0.0
PyQt6: 6.4.2
PyQt6-Qt6: 6.4.3
PyQt6-sip: 13.4.1
PyQt6-WebEngine: 6.4.0
PyQt6-WebEngine-Qt6: 6.4.3
python-dateutil: 2.8.2
pytz: 2023.3
pyzmq: 25.1.0
qtconsole: 5.4.3
QtPy: 2.3.1
RandomWords: 0.4.0
requests: 2.31.0
scipy: 1.9.3
setuptools: 67.4.0
setuptools-scm: 7.0.5
sfftk-rw: 0.7.3
six: 1.16.0
snowballstemmer: 2.2.0
sortedcontainers: 2.4.0
soupsieve: 2.4.1
sphinx: 6.1.3
sphinx-autodoc-typehints: 1.22
sphinxcontrib-applehelp: 1.0.4
sphinxcontrib-blockdiag: 3.0.0
sphinxcontrib-devhelp: 1.0.2
sphinxcontrib-htmlhelp: 2.0.1
sphinxcontrib-jsmath: 1.0.1
sphinxcontrib-qthelp: 1.0.3
sphinxcontrib-serializinghtml: 1.1.5
stack-data: 0.6.2
tables: 3.8.0
tcia-utils: 1.2.0
tifffile: 2022.10.10
tinyarray: 1.2.4
tomli: 2.0.1
tornado: 6.3.2
traitlets: 5.9.0
typing-extensions: 4.6.3
tzdata: 2023.3
urllib3: 2.0.3
wcwidth: 0.2.6
webcolors: 1.12
wheel: 0.38.4
wheel-filename: 1.4.1
widgetsnbextension: 4.0.7
File attachment: alignment.ali
Attachments (1)
Change History (3)
by , 3 years ago
| Attachment: | alignment.ali added |
|---|
comment:1 by , 3 years ago
| Cc: | added |
|---|---|
| Component: | Unassigned → Structure Prediction |
| Owner: | set to |
| Platform: | → all |
| Project: | → ChimeraX |
| Status: | new → accepted |
| Summary: | ChimeraX bug report submission → "Direct" modeling doesn't handle target deletion relative to template |
comment:2 by , 3 years ago
| Resolution: | → fixed |
|---|---|
| Status: | accepted → closed |
Fix in next daily build.
Fix: https://github.com/RBVI/ChimeraX/commit/60e2494fda5f8f56c93d1f1fe1a07b3034f7d88a
Note:
See TracTickets
for help on using tickets.
Added by email2trac