1 | # Fetch ID
|
---|
2 | open 6NQ3
|
---|
3 |
|
---|
4 | # Set up the structures to view
|
---|
5 | select all ; show sel cartoons; style sel stick; hide sel atoms
|
---|
6 | select /A,B,C,G,D,H ; hide sel cartoons
|
---|
7 | select /E ; color (#!1 & sel) purple
|
---|
8 | select /F ; color (#!1 & sel) cyan
|
---|
9 | select clear
|
---|
10 |
|
---|
11 | # Set starting view
|
---|
12 | set bgColor white
|
---|
13 | lighting soft
|
---|
14 | graphics silhouettes true
|
---|
15 | view
|
---|
16 | view name start
|
---|
17 |
|
---|
18 | # Start the movie production
|
---|
19 | movie record supersample 1 size 720,720 limit 5000 directory ~/Desktop/tmp_chimera pattern Frame_n*
|
---|
20 |
|
---|
21 | # Set starting through the hole of Rbbp4
|
---|
22 | turn z -70
|
---|
23 | turn x 24
|
---|
24 | turn y -40
|
---|
25 | view name hole
|
---|
26 | wait 5
|
---|
27 |
|
---|
28 | # colour Histone-binding protein RBBP4 or subunit C of CAF1 complex; Region: CAF1C_H4-bd; pfam12265
|
---|
29 | select sequence EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLP ; color sel orange
|
---|
30 | select clear ; wait 10
|
---|
31 |
|
---|
32 | # Colour the WD40 repeat 1
|
---|
33 | select sequence NHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYT ; color sel spring green
|
---|
34 | select clear ; wait 10
|
---|
35 | # Colour the WD40 repeat 2
|
---|
36 | select sequence GHQKEGYGLSWNPNLSGHLLSASDDHTICLWD ; color sel spring green
|
---|
37 | select clear ; wait 10
|
---|
38 | # WD40 repeat 3
|
---|
39 | select sequence GHTAVVEDVSWHLLHESLFGSVADDQKLMIWD ; color sel spring green
|
---|
40 | select clear ; wait 10
|
---|
41 | # WD40 repeat 4
|
---|
42 | select sequence AHTAEVNCLSFNPYSEFILATGSADKTVALWD ; color sel spring green
|
---|
43 | select clear ; wait 10
|
---|
44 | # WD40 repeat 5
|
---|
45 | select sequence SHKDEIFQVQWSPHNETILASSGTDRRLNVWD ; color sel spring green
|
---|
46 | select clear ; wait 10
|
---|
47 | # WD40 repeat 6
|
---|
48 | select sequence GHTAKISDFSWNPNEPWVICSVSEDNIMQVWQ ; color sel spring green
|
---|
49 | select clear ; wait 10
|
---|
50 |
|
---|
51 | # Show altenative exon
|
---|
52 | select sequence RKTFKVDDMLSKVEKMKGEQESH
|
---|
53 | color sel red
|
---|
54 | select clear
|
---|
55 | wait 10
|
---|
56 |
|
---|
57 |
|
---|
58 | # All structure overview
|
---|
59 | turn x 20 120 rock 120 ; wait
|
---|
60 | turn y 35 150 rock 150 ; wait
|
---|
61 | turn y 4 90 ; wait
|
---|
62 |
|
---|
63 |
|
---|
64 | # Show first point of interaction with yellow region
|
---|
65 | turn y 1 50 ; wait
|
---|
66 | turn x 1 35 ; wait
|
---|
67 | zoom 1.5 80 ; wait
|
---|
68 | move x 0.75 15 ; move y -0.75 15 ; wait
|
---|
69 | view name side
|
---|
70 |
|
---|
71 | # Show side chains interacting
|
---|
72 | select /E:9-28 /E:32-39
|
---|
73 | show sel atoms
|
---|
74 | hbonds sel
|
---|
75 | select clear
|
---|
76 | wait 20
|
---|
77 | turn x 15 60 rock 60 ; wait
|
---|
78 | turn y 15 60 rock 60; wait
|
---|
79 |
|
---|
80 | # remove hydrogen bonds and
|
---|
81 | ~hbonds
|
---|
82 | select /E:9-28 /E:32-39
|
---|
83 | hide sel atoms
|
---|
84 | select clear
|
---|
85 | wait 5
|
---|
86 |
|
---|
87 | # go back
|
---|
88 | move y 0.75 15 ; move x -0.75 15 ; wait
|
---|
89 | zoom 0.5 80 ; wait
|
---|
90 | turn -x 1 35 ; wait
|
---|
91 | turn -y 1 50 ; wait
|
---|
92 | view hole
|
---|
93 | # the going back to 'hole' position is a bit abrupt
|
---|
94 |
|
---|
95 | # Close up to region 1
|
---|
96 | move x 0.75 25 ; move y -0.5 25 ; wait 25
|
---|
97 | turn x 0.5 25 ; zoom 3 80 ; wait 80
|
---|
98 | turn x 0.75 25 ; move y 0.5 25 ; wait 25
|
---|
99 | view name zoom1
|
---|
100 |
|
---|
101 | # Show residues interacting with R129
|
---|
102 | select /F:129 /E:409 /E:346 ; show sel atoms; color (#!1 & sel) byelement ; hbonds sel
|
---|
103 | select clear
|
---|
104 | wait 15
|
---|
105 | turn -y 15 120 rock 120 ; wait
|
---|
106 | turn x 15 60 rock 130 ; wait
|
---|
107 | wait 15
|
---|
108 | view name zoom2
|
---|
109 |
|
---|
110 | # Move to next site Asp 129
|
---|
111 | turn y -1.5 25 ; move x -0.5 25 ; wait 25
|
---|
112 | turn x -1 25 ; turn z 1 25 ; move x 0.4 25 ; wait 25
|
---|
113 |
|
---|
114 | # Show residues interacting with ASP135
|
---|
115 | select /F:135 /E:285,304,330 ; show sel atoms; color (#!1 & sel) byelement ; hbonds sel
|
---|
116 | select clear
|
---|
117 | turn y -10 120 rock 180 ; wait
|
---|
118 | turn x 15 120 rock 120 ; wait
|
---|
119 | wait 20
|
---|
120 | view name zoom3
|
---|
121 |
|
---|
122 | # zoom out and move to other region
|
---|
123 | zoom 0.5 50 ; turn -y 1 150 ; wait
|
---|
124 | move x 0.75 15 ; wait
|
---|
125 | turn x 1 20 ; wait
|
---|
126 | zoom 1.5 50
|
---|
127 |
|
---|
128 | # Select last interaction area
|
---|
129 | select /F:370,375 /E:270,309,314
|
---|
130 | show sel atoms
|
---|
131 | hbonds sel
|
---|
132 | select clear
|
---|
133 |
|
---|
134 | # Final show
|
---|
135 | turn x 15 60 rock 130
|
---|
136 | turn -y 15 60 rock 130
|
---|
137 |
|
---|
138 | # Print status in log
|
---|
139 | movie status
|
---|
140 |
|
---|
141 | # Export movie
|
---|
142 | movie encode ~/Desktop/Suz12_test1.mp4 format h264 quality low wait true verbose false
|
---|
143 | # close
|
---|