id summary reporter owner description type status priority milestone component version resolution keywords cc blockedby blocking notify_on_close platform project 20389 ChimeraX bug report submission chimerax-bug-report@… "{{{ The following bug report has been submitted: Platform: macOS-26.5-arm64-arm-64bit ChimeraX Version: 1.11.1 (2026-01-23 05:51:34 UTC) Description Replace this text with list of actions that caused this problem to occur Log: UCSF ChimeraX version: 1.11.1 (2026-01-23) © 2016-2025 Regents of the University of California. All rights reserved. How to cite UCSF ChimeraX > open 6ete fromDatabase pdb format mmcif Summary of feedback from opening 6ete fetched from pdb --- notes | Fetching compressed mmCIF 6ete from http://files.rcsb.org/download/6ete.cif Fetching CCD BWK from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/K/BWK/BWK.cif 6ete title: Crystal structure of KDM4D with tetrazolhydrazide compound 5 [more info...] Chain information for 6ete #1 --- Chain | Description | UniProt A | Lysine-specific demethylase 4D | KDM4D_HUMAN 1-342 Non-standard residues in 6ete #1 --- BWK — [2-(1-methyl-1,2,3,4-tetrazol-4-ium-5-yl)ethanoylamino]azanium EDO — 1,2-ethanediol (ethylene glycol) NI — nickel (II) ion SO4 — sulfate ion ZN — zinc ion 569 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 3090 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. > close #1 > open 6et6 fromDatabase pdb format mmcif 6et6 title: Crystal structure of muramidase from Acinetobacter baumannii AB 5075UW prophage [more info...] Chain information for 6et6 #1 --- Chain | Description | UniProt A | Lysozyme | A0A0D5YGK2_ACIBA 14-196 Non-standard residues in 6et6 #1 --- GOL — glycerol (glycerin; propane-1,2,3-triol) SO4 — sulfate ion 13 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 1378 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. > open ""/Users/gth_book/Documents/1_JOB_Files/Research_Proj_Prop/★ > Prop_2024_Enzybiotics ▲ 🌱/Structures_Analysis/Structures from > PDB/AbLys1_8APP.cif"" AbLys1_8APP.cif title: AbLys1 endolysin from Acinetobacter baumannii phage AbTZA1 [more info...] Chain information for AbLys1_8APP.cif #2 --- Chain | Description | UniProt A B C D | Endolysin | A0A3T0IGR7_9CAUD 1-187 Non-standard residues in AbLys1_8APP.cif #2 --- GOL — glycerol (glycerin; propane-1,2,3-triol) PO4 — phosphate ion AbLys1_8APP.cif mmCIF Assemblies --- 1| author_and_software_defined_assembly > close #2 > open ""/Users/gth_book/Documents/1_JOB_Files/Research_Proj_Prop/★ > Prop_2024_Enzybiotics ▲ 🌱/Structures_Analysis/Structure > analysis/AbLys1_8APP_monom.pdb"" Chain information for AbLys1_8APP_monom.pdb #2 --- Chain | Description A | No description available > hide #2 models > ui tool show Matchmaker > matchmaker #2 to #1 Parameters --- Chain pairing | bb Alignment algorithm | Needleman-Wunsch Similarity matrix | BLOSUM-62 SS fraction | 0.3 Gap open (HH/SS/other) | 18/18/6 Gap extend | 1 SS matrix | | | H | S | O ---|---|---|--- H | 6 | -9 | -6 S | | 6 | -6 O | | | 4 Iteration cutoff | 2 Matchmaker 6et6, chain A (#1) with AbLys1_8APP_monom.pdb, chain A (#2), sequence alignment score = 597.2 RMSD between 94 pruned atom pairs is 0.530 angstroms; (across all 149 pairs: 4.699) > show #2 models > hide #2 models > hide #1 models > close #1 > ui tool show ""Similar Structures"" > foldseek /A Found 463 similar structures to AbLys1_8APP_monom.pdb #2/A in pdb database using foldseek, name fs1 > show #2 models > open 6et6 6et6 title: Crystal structure of muramidase from Acinetobacter baumannii AB 5075UW prophage [more info...] Chain information for 6et6 #1 --- Chain | Description | UniProt A | Lysozyme | A0A0D5YGK2_ACIBA 14-196 Non-standard residues in 6et6 #1 --- GOL — glycerol (glycerin; propane-1,2,3-triol) SO4 — sulfate ion 13 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 1378 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 3 N-terminal residues, 84 non-polymer residues more than 3.0 Angstroms away. Alignment of 6et6 chain A to query has RMSD 0.52 using 93 of 146 paired residues within cutoff distance 2.0 > open 7m5i 7m5i title: Endolysin from Escherichia coli O157:H7 phage FAHEc1 [more info...] Chain information for 7m5i #3 --- Chain | Description | UniProt A B | Endolysin | A0A0F6R9G3_9CAUD 1-154 Non-standard residues in 7m5i #3 --- PO4 — phosphate ion 7m5i mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 8 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 2475 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 7 C-terminal residues, 5 N-terminal residues, 213 non- polymer residues more than 3.0 Angstroms away. Alignment of 7m5i chain B to query has RMSD 0.911 using 107 of 146 paired residues within cutoff distance 2.0 > hide #2 models > show #2 models > hide #1 models > select #2/A:159 14 atoms, 15 bonds, 1 residue, 1 model selected > show sel atoms > open 2anv 2anv title: crystal structure of P22 lysozyme mutant L86M [more info...] Chain information for 2anv #4 --- Chain | Description | UniProt A B | Lysozyme | LYS_BPP22 1-146 Non-standard residues in 2anv #4 --- CL — chloride ion IOD — iodide ion MG — magnesium ion SM — samarium (III) ion SO4 — sulfate ion 2anv mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| software_defined_assembly 3| software_defined_assembly 165 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 2792 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 2 N-terminal residues, 378 non-polymer residues more than 3.0 Angstroms away. Alignment of 2anv chain A to query has RMSD 1.04 using 129 of 144 paired residues within cutoff distance 2.0 > open 4zpu 4zpu title: The structure of DLP12 endolysin exhibits likely active and inactive conformations. [more info...] Chain information for 4zpu #5 --- Chain | Description | UniProt A B C D | Lysozyme RrrD | LYSD_ECOLI 1-165 Non-standard residues in 4zpu #5 --- ACT — acetate ion FMT — formic acid 4zpu mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 3 extra chains, 5 C-terminal residues, 19 N-terminal residues, 45 non- polymer residues more than 3.0 Angstroms away. Alignment of 4zpu chain A to query has RMSD 0.855 using 87 of 135 paired residues within cutoff distance 2.0 > open 8hp8 8hp8 title: Crystal Structure of Engineered Endolysin EC340 derived from Gram-Negative Bacteria targeted Bacteriophage [more info...] Chain information for 8hp8 #6 --- Chain | Description A B C | Endolysin mtEC340M 8hp8 mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 3| author_defined_assembly Deleted 2 extra chains, 13 C-terminal residues, 2 N-terminal residues, 255 non-polymer residues more than 3.0 Angstroms away. Alignment of 8hp8 chain C to query has RMSD 0.877 using 114 of 142 paired residues within cutoff distance 2.0 > open 3hde 3hde title: Crystal structure of full-length endolysin R21 from phage 21 [more info...] Chain information for 3hde #7 --- Chain | Description | UniProt A B C D | Lysozyme | LYS_BPP21 1-165 3hde mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 3 extra chains, 3 C-terminal residues, 19 N-terminal residues, 325 non-polymer residues more than 3.0 Angstroms away. Alignment of 3hde chain C to query has RMSD 0.97 using 93 of 136 paired residues within cutoff distance 2.0 > open 8b2s 8b2s title: GH24 family muramidase from Trichophaea saccata with an SH3-like cell wall binding domain [more info...] Chain information for 8b2s #8 --- Chain | Description A B | GH24 family muramidase Non-standard residues in 8b2s #8 --- K — potassium ion 8b2s mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 37 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 3610 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 10 C-terminal residues, 79 N-terminal residues, 274 non-polymer residues more than 3.0 Angstroms away. Alignment of 8b2s chain B to query has RMSD 0.925 using 101 of 145 paired residues within cutoff distance 2.0 > open 1xjt 1xjt title: Crystal structure of active form of P1 phage endolysin Lyz [more info...] Chain information for 1xjt #9 --- Chain | Description | UniProt A | Lysozyme | LYS_BPP1 1-185 Non-standard residues in 1xjt #9 --- CIT — citric acid Deleted 8 C-terminal residues, 73 non-polymer residues more than 3.0 Angstroms away. Alignment of 1xjt chain A to query has RMSD 1 using 80 of 158 paired residues within cutoff distance 2.0 > open 3hde 3hde title: Crystal structure of full-length endolysin R21 from phage 21 [more info...] Chain information for 3hde #10 --- Chain | Description | UniProt A B C D | Lysozyme | LYS_BPP21 1-165 3hde mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 3 extra chains, 4 C-terminal residues, 19 N-terminal residues, 327 non-polymer residues more than 3.0 Angstroms away. Alignment of 3hde chain D to query has RMSD 0.782 using 80 of 126 paired residues within cutoff distance 2.0 > open 1jqu 1jqu title: Are Carboxy Terminii of Helices Coded by the Local Sequence or by Tertiary Structure Contacts [more info...] Chain information for 1jqu #11 --- Chain | Description | UniProt A B C D | Lysozyme | LYS_BPT4 1-164 1jqu mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 3| author_defined_assembly 4| author_defined_assembly Deleted 3 extra chains, 11 C-terminal residues, 1 N-terminal residues, 23 non- polymer residues more than 3.0 Angstroms away. Alignment of 1jqu chain C to query has RMSD 1.11 using 51 of 124 paired residues within cutoff distance 2.0 > open 3fi5 3fi5 title: Crystal Structure of T4 Lysozyme Mutant R96W [more info...] Chain information for 3fi5 #12 --- Chain | Description | UniProt A B C D | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3fi5 #12 --- CL — chloride ion IPA — isopropyl alcohol (2-propanol) NA — sodium ion 3fi5 mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 3| author_and_software_defined_assembly 4| author_and_software_defined_assembly 360 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 5242 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 3 extra chains, 9 C-terminal residues, 2 N-terminal residues, 902 non- polymer residues more than 3.0 Angstroms away. Alignment of 3fi5 chain C to query has RMSD 0.948 using 46 of 124 paired residues within cutoff distance 2.0 > open 6a73 6a73 title: Complex structure of CSN2 with IP6 [more info...] Chain information for 6a73 #13 --- Chain | Description | UniProt A B | COP9 signalosome complex subunit 2,Endolysin | CSN2_HUMAN 29-162, A0A097J809_BPT4 163-325 Non-standard residues in 6a73 #13 --- IHP — inositol hexakisphosphate (myo-inositol hexakisphosphate; inositol 1,2,3,4,5,6-hexakisphosphate) SO4 — sulfate ion 6a73 mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 4968 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 8 C-terminal residues, 95 N-terminal residues, 137 non-polymer residues more than 3.0 Angstroms away. Alignment of 6a73 chain B to query has RMSD 1.17 using 64 of 153 paired residues within cutoff distance 2.0 > open 192l Summary of feedback from opening 192l fetched from pdb --- note | Fetching compressed mmCIF 192l from http://files.rcsb.org/download/192l.cif 192l title: A helix initiation signal In T4 lysozyme identified by polyalanine mutagenesis [more info...] Chain information for 192l #14 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 192l #14 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 7 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues more than 3.0 Angstroms away. Alignment of 192l chain A to query has RMSD 0.836 using 41 of 127 paired residues within cutoff distance 2.0 > close > open ""/Users/gth_book/Documents/1_JOB_Files/Research_Proj_Prop/★ > Prop_2024_Enzybiotics ▲ 🌱/Structures_Analysis/Structure > analysis/AbLys1_8APP_monom.pdb"" Chain information for AbLys1_8APP_monom.pdb #1 --- Chain | Description A | No description available > open 6et6 6et6 title: Crystal structure of muramidase from Acinetobacter baumannii AB 5075UW prophage [more info...] Chain information for 6et6 #2 --- Chain | Description | UniProt A | Lysozyme | A0A0D5YGK2_ACIBA 14-196 Non-standard residues in 6et6 #2 --- GOL — glycerol (glycerin; propane-1,2,3-triol) SO4 — sulfate ion 13 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 1378 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 3 N-terminal residues, 84 non-polymer residues more than 3.0 Angstroms away. > close #2 > foldseek /A Found 404 similar structures to AbLys1_8APP_monom.pdb #1/A in pdb database using foldseek, name fs2 > open 6et6 6et6 title: Crystal structure of muramidase from Acinetobacter baumannii AB 5075UW prophage [more info...] Chain information for 6et6 #2 --- Chain | Description | UniProt A | Lysozyme | A0A0D5YGK2_ACIBA 14-196 Non-standard residues in 6et6 #2 --- GOL — glycerol (glycerin; propane-1,2,3-triol) SO4 — sulfate ion 13 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 1378 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 3 N-terminal residues, 84 non-polymer residues more than 3.0 Angstroms away. Alignment of 6et6 chain A to query has RMSD 0.52 using 93 of 146 paired residues within cutoff distance 2.0 > similarstructures sequences > similarstructures traces 404 backbone traces > close #3 > similarstructures cluster #1/A:131,64,88,177,69 clusterDistance 1.5 Clustered 392 of 404 hits that have the specified 5 residues into 2 groups > similarstructures sequences > color byattribute r:coverage #1/A palette 0,red:202,white:404,blue 1631 atoms, 342 residues, atom coverage range 1 to 404 > color byattribute r:conservation #1/A palette 0,blue:0.25,white:0.5,red 1631 atoms, 342 residues, atom conservation range 0.176 to 1 > color #1/A gray > color #1/A & ::conservation>=0.5 red > color byattribute r:lddt #1/A palette > 0,red:0.2,orange:0.4,yellow:0.6,cornflowerblue:0.8,blue 1631 atoms, 342 residues, atom lddt range 0.337 to 1 7m5i title: Endolysin from Escherichia coli O157:H7 phage FAHEc1 [more info...] Chain information for 7m5i #3 --- Chain | Description | UniProt A B | Endolysin | A0A0F6R9G3_9CAUD 1-154 Non-standard residues in 7m5i #3 --- PO4 — phosphate ion 7m5i mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 8 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 2475 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 7 C-terminal residues, 5 N-terminal residues, 213 non- polymer residues more than 3.0 Angstroms away. Alignment of 7m5i chain B to query has RMSD 0.911 using 107 of 146 paired residues within cutoff distance 2.0 6h9d title: Muramidase domain of SpmX from Asticaccaulis excentricus [more info...] Chain information for 6h9d #4 --- Chain | Description | UniProt A B C | Lysozyme | E8RMG8_ASTEC 2-150 Non-standard residues in 6h9d #4 --- CL — chloride ion GOL — glycerol (glycerin; propane-1,2,3-triol) 6h9d mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 3| author_defined_assembly 5 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 2 extra chains, 2 N-terminal residues, 132 non-polymer residues more than 3.0 Angstroms away. Alignment of 6h9d chain C to query has RMSD 0.804 using 99 of 145 paired residues within cutoff distance 2.0 2anv title: crystal structure of P22 lysozyme mutant L86M [more info...] Chain information for 2anv #5 --- Chain | Description | UniProt A B | Lysozyme | LYS_BPP22 1-146 Non-standard residues in 2anv #5 --- CL — chloride ion IOD — iodide ion MG — magnesium ion SM — samarium (III) ion SO4 — sulfate ion 2anv mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| software_defined_assembly 3| software_defined_assembly 165 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 2792 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 2 N-terminal residues, 378 non-polymer residues more than 3.0 Angstroms away. Alignment of 2anv chain A to query has RMSD 1.04 using 129 of 144 paired residues within cutoff distance 2.0 4zpu title: The structure of DLP12 endolysin exhibits likely active and inactive conformations. [more info...] Chain information for 4zpu #6 --- Chain | Description | UniProt A B C D | Lysozyme RrrD | LYSD_ECOLI 1-165 Non-standard residues in 4zpu #6 --- ACT — acetate ion FMT — formic acid 4zpu mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 3 extra chains, 5 C-terminal residues, 19 N-terminal residues, 45 non- polymer residues more than 3.0 Angstroms away. Alignment of 4zpu chain A to query has RMSD 0.855 using 87 of 135 paired residues within cutoff distance 2.0 8hp8 title: Crystal Structure of Engineered Endolysin EC340 derived from Gram-Negative Bacteria targeted Bacteriophage [more info...] Chain information for 8hp8 #7 --- Chain | Description A B C | Endolysin mtEC340M 8hp8 mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 3| author_defined_assembly Deleted 2 extra chains, 13 C-terminal residues, 2 N-terminal residues, 255 non-polymer residues more than 3.0 Angstroms away. Alignment of 8hp8 chain C to query has RMSD 0.877 using 114 of 142 paired residues within cutoff distance 2.0 3hde title: Crystal structure of full-length endolysin R21 from phage 21 [more info...] Chain information for 3hde #8 --- Chain | Description | UniProt A B C D | Lysozyme | LYS_BPP21 1-165 3hde mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 3 extra chains, 3 C-terminal residues, 19 N-terminal residues, 325 non-polymer residues more than 3.0 Angstroms away. Alignment of 3hde chain C to query has RMSD 0.97 using 93 of 136 paired residues within cutoff distance 2.0 8b2s title: GH24 family muramidase from Trichophaea saccata with an SH3-like cell wall binding domain [more info...] Chain information for 8b2s #9 --- Chain | Description A B | GH24 family muramidase Non-standard residues in 8b2s #9 --- K — potassium ion 8b2s mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 37 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 3610 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 10 C-terminal residues, 79 N-terminal residues, 274 non-polymer residues more than 3.0 Angstroms away. Alignment of 8b2s chain B to query has RMSD 0.925 using 101 of 145 paired residues within cutoff distance 2.0 1xjt title: Crystal structure of active form of P1 phage endolysin Lyz [more info...] Chain information for 1xjt #10 --- Chain | Description | UniProt A | Lysozyme | LYS_BPP1 1-185 Non-standard residues in 1xjt #10 --- CIT — citric acid Deleted 8 C-terminal residues, 73 non-polymer residues more than 3.0 Angstroms away. Alignment of 1xjt chain A to query has RMSD 1 using 80 of 158 paired residues within cutoff distance 2.0 3hde title: Crystal structure of full-length endolysin R21 from phage 21 [more info...] Chain information for 3hde #11 --- Chain | Description | UniProt A B C D | Lysozyme | LYS_BPP21 1-165 3hde mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 3 extra chains, 4 C-terminal residues, 19 N-terminal residues, 327 non-polymer residues more than 3.0 Angstroms away. Alignment of 3hde chain D to query has RMSD 0.782 using 80 of 126 paired residues within cutoff distance 2.0 1jqu title: Are Carboxy Terminii of Helices Coded by the Local Sequence or by Tertiary Structure Contacts [more info...] Chain information for 1jqu #12 --- Chain | Description | UniProt A B C D | Lysozyme | LYS_BPT4 1-164 1jqu mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 3| author_defined_assembly 4| author_defined_assembly Deleted 3 extra chains, 11 C-terminal residues, 1 N-terminal residues, 23 non- polymer residues more than 3.0 Angstroms away. Alignment of 1jqu chain C to query has RMSD 1.11 using 51 of 124 paired residues within cutoff distance 2.0 3fi5 title: Crystal Structure of T4 Lysozyme Mutant R96W [more info...] Chain information for 3fi5 #13 --- Chain | Description | UniProt A B C D | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3fi5 #13 --- CL — chloride ion IPA — isopropyl alcohol (2-propanol) NA — sodium ion 3fi5 mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 3| author_and_software_defined_assembly 4| author_and_software_defined_assembly 360 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 5242 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 3 extra chains, 9 C-terminal residues, 2 N-terminal residues, 902 non- polymer residues more than 3.0 Angstroms away. Alignment of 3fi5 chain C to query has RMSD 0.948 using 46 of 124 paired residues within cutoff distance 2.0 6a73 title: Complex structure of CSN2 with IP6 [more info...] Chain information for 6a73 #14 --- Chain | Description | UniProt A B | COP9 signalosome complex subunit 2,Endolysin | CSN2_HUMAN 29-162, A0A097J809_BPT4 163-325 Non-standard residues in 6a73 #14 --- IHP — inositol hexakisphosphate (myo-inositol hexakisphosphate; inositol 1,2,3,4,5,6-hexakisphosphate) SO4 — sulfate ion 6a73 mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 4968 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 8 C-terminal residues, 95 N-terminal residues, 137 non-polymer residues more than 3.0 Angstroms away. Alignment of 6a73 chain B to query has RMSD 1.17 using 64 of 153 paired residues within cutoff distance 2.0 192l title: A helix initiation signal In T4 lysozyme identified by polyalanine mutagenesis [more info...] Chain information for 192l #15 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 192l #15 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 7 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues more than 3.0 Angstroms away. Alignment of 192l chain A to query has RMSD 0.836 using 41 of 127 paired residues within cutoff distance 2.0 137l title: Structural basis of amino acid α helix propensity [more info...] Chain information for 137l #16 --- Chain | Description | UniProt A B | T4 LYSOZYME | LYS_BPT4 1-164 137l mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 186 non-polymer residues more than 3.0 Angstroms away. Alignment of 137l chain B to query has RMSD 0.973 using 49 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 5vnq from http://files.rcsb.org/download/5vnq.cif Atom D1 is not in the residue template for MET /A:1 Atom D is not in the residue template for ASN /A:2 Atom D is not in the residue template for ILE /A:3 Atom D is not in the residue template for PHE /A:4 Atom D is not in the residue template for GLU /A:5 Atom D is not in the residue template for MET /A:6 Atom D is not in the residue template for LEU /A:7 Atom D is not in the residue template for ARG /A:8 Atom D is not in the residue template for ILE /A:9 Too many hydrogens missing from residue template(s) to warn about 5vnq title: Neutron crystallographic structure of perdeuterated T4 lysozyme cysteine-free pseudo-wild type at cryogenic temperature [more info...] Chain information for 5vnq #17 --- Chain | Description | UniProt A | Endolysin | D9IEF7_BPT4 1-164 Non-standard residues in 5vnq #17 --- CL — chloride ion 656 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 4 non-polymer residues more than 3.0 Angstroms away. Alignment of 5vnq chain A to query has RMSD 0.995 using 48 of 126 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 5kim from http://files.rcsb.org/download/5kim.cif Fetching CCD PHI from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/I/PHI/PHI.cif 5kim title: Pseudo T4 lysozyme mutant - Y88PHE-I [more info...] Chain information for 5kim #18 --- Chain | Description | UniProt A | Endolysin | ENLYS_BPT4 1-164 Non-standard residues in 5kim #18 --- HED — 2-hydroxyethyl disulfide NA — sodium ion 138 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 9 C-terminal residues, 2 N-terminal residues, 204 non-polymer residues more than 3.0 Angstroms away. Alignment of 5kim chain A to query has RMSD 0.968 using 49 of 124 paired residues within cutoff distance 2.0 5jgx title: Spin-Labeled T4 Lysozyme Construct V131V1 [more info...] Chain information for 5jgx #19 --- Chain | Description | UniProt A | Endolysin | ENLYS_BPT4 1-164 Non-standard residues in 5jgx #19 --- CL — chloride ion K — potassium ion PO4 — phosphate ion V1A — S-(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-imidazol-4-yl) methanesulfonothioate 37 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 162 non-polymer residues more than 3.0 Angstroms away. Alignment of 5jgx chain A to query has RMSD 0.993 using 50 of 124 paired residues within cutoff distance 2.0 3hdf title: Crystal structure of truncated endolysin R21 from phage 21 [more info...] Chain information for 3hdf #20 --- Chain | Description | UniProt A B | Lysozyme | LYS_BPP21 27-165 Non-standard residues in 3hdf #20 --- GOL — glycerol (glycerin; propane-1,2,3-triol) NO3 — nitrate ion 3hdf mmCIF Assemblies --- 1| software_defined_assembly 2| software_defined_assembly 17 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 1 extra chains, 1 C-terminal residues, 3 N-terminal residues, 245 non- polymer residues more than 3.0 Angstroms away. Alignment of 3hdf chain B to query has RMSD 1.17 using 67 of 124 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 2o79 from http://files.rcsb.org/download/2o79.cif 2o79 title: T4 lysozyme with C-terminal extension [more info...] Chain information for 2o79 #21 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 2o79 #21 --- CL — chloride ion GOL — glycerol (glycerin; propane-1,2,3-triol) PO4 — phosphate ion 31 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 9 C-terminal residues, 2 N-terminal residues, 113 non-polymer residues more than 3.0 Angstroms away. Alignment of 2o79 chain A to query has RMSD 1 using 50 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 216l from http://files.rcsb.org/download/216l.cif 216l title: Structural basis of α-helix propensity At two sites In T4 lysozyme [more info...] Chain information for 216l #22 --- Chain | Description | UniProt A B | T4 LYSOZYME | LYS_BPT4 1-164 216l mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 14 non- polymer residues more than 3.0 Angstroms away. Alignment of 216l chain B to query has RMSD 0.964 using 47 of 122 paired residues within cutoff distance 2.0 5jgu title: Spin-Labeled T4 Lysozyme Construct R119V1 [more info...] Chain information for 5jgu #23 --- Chain | Description | UniProt A | Endolysin | ENLYS_BPT4 1-164 Non-standard residues in 5jgu #23 --- CL — chloride ion K — potassium ion PO4 — phosphate ion V1A — S-(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-imidazol-4-yl) methanesulfonothioate 42 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 157 non-polymer residues more than 3.0 Angstroms away. Alignment of 5jgu chain A to query has RMSD 0.984 using 50 of 125 paired residues within cutoff distance 2.0 4arj title: Crystal structure of a pesticin (translocation and receptor binding domain) from Y. pestis and T4-lysozyme chimera [more info...] Chain information for 4arj #24 --- Chain | Description | UniProt A B | PESTICIN, LYSOZYME | Q57159_YERPE 1-167, LYS_BPT4 169-331 Non-standard residues in 4arj #24 --- SO4 — sulfate ion 4arj mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 11 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 5079 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 14 C-terminal residues, 136 N-terminal residues, 57 non-polymer residues more than 3.0 Angstroms away. Alignment of 4arj chain B to query has RMSD 0.996 using 59 of 140 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 3sb6 from http://files.rcsb.org/download/3sb6.cif Fetching CCD CU from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/U/CU/CU.cif 3sb6 title: Cu-mediated Dimer of T4 Lysozyme D61H/K65H/R76H/R80H by Synthetic Symmetrization [more info...] Chain information for 3sb6 #25 --- Chain | Description | UniProt A B | Lysozyme | LYS_BPT4 1-162 Non-standard residues in 3sb6 #25 --- CL — chloride ion CU — copper (II) ion 2536 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 9 C-terminal residues, 4 N-terminal residues, 19 non- polymer residues more than 3.0 Angstroms away. Alignment of 3sb6 chain A to query has RMSD 0.957 using 46 of 127 paired residues within cutoff distance 2.0 137l title: Structural basis of amino acid α helix propensity [more info...] Chain information for 137l #26 --- Chain | Description | UniProt A B | T4 LYSOZYME | LYS_BPT4 1-164 137l mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 168 non- polymer residues more than 3.0 Angstroms away. Alignment of 137l chain A to query has RMSD 1 using 49 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 2q9d from http://files.rcsb.org/download/2q9d.cif 2q9d title: Structure of spin-labeled T4 lysozyme mutant A41R1 [more info...] Chain information for 2q9d #27 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 2q9d #27 --- BME — β-mercaptoethanol MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate (MTSL) 1556 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 11 C-terminal residues, 2 N-terminal residues, 99 non-polymer residues more than 3.0 Angstroms away. Alignment of 2q9d chain A to query has RMSD 1.03 using 51 of 124 paired residues within cutoff distance 2.0 217l title: Structural basis of α-helix propensity At two sites In T4 lysozyme [more info...] Chain information for 217l #28 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 217l #28 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 86 non-polymer residues more than 3.0 Angstroms away. Alignment of 217l chain A to query has RMSD 0.98 using 48 of 124 paired residues within cutoff distance 2.0 201l title: How amino-acid insertions are allowed In an α-helix of T4 lysozyme [more info...] Chain information for 201l #29 --- Chain | Description | UniProt A B | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 201l #29 --- BME — β-mercaptoethanol 201l mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 85 non- polymer residues more than 3.0 Angstroms away. Alignment of 201l chain B to query has RMSD 0.984 using 50 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 6pgz from http://files.rcsb.org/download/6pgz.cif 6pgz title: MTSL labelled T4 lysozyme pseudo-wild type V75C mutant [more info...] Chain information for 6pgz #30 --- Chain | Description | UniProt A B | Endolysin | D9IEF7_BPT4 1-164 Non-standard residues in 6pgz #30 --- CL — chloride ion MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate (MTSL) 6pgz mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 51 non- polymer residues more than 3.0 Angstroms away. Alignment of 6pgz chain B to query has RMSD 0.999 using 48 of 124 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 5ki1 from http://files.rcsb.org/download/5ki1.cif 5ki1 title: Pseudo T4 lysozyme mutant - Y18F [more info...] Chain information for 5ki1 #31 --- Chain | Description | UniProt A | Endolysin | ENLYS_BPT4 1-164 Non-standard residues in 5ki1 #31 --- HED — 2-hydroxyethyl disulfide 22 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 9 C-terminal residues, 2 N-terminal residues, 161 non-polymer residues more than 3.0 Angstroms away. Alignment of 5ki1 chain A to query has RMSD 1.01 using 49 of 126 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 5jgn from http://files.rcsb.org/download/5jgn.cif 5jgn title: Spin-Labeled T4 Lysozyme Construct I9V1 [more info...] Chain information for 5jgn #32 --- Chain | Description | UniProt A | Endolysin | ENLYS_BPT4 1-164 Non-standard residues in 5jgn #32 --- CL — chloride ion K — potassium ion PO4 — phosphate ion V1A — S-(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-imidazol-4-yl) methanesulfonothioate 33 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 168 non-polymer residues more than 3.0 Angstroms away. Alignment of 5jgn chain A to query has RMSD 0.959 using 49 of 124 paired residues within cutoff distance 2.0 1t97 title: Use of sequence duplication to engineer a ligand-triggered long-distance molecular switch in T4 Lysozyme [more info...] Chain information for 1t97 #33 --- Chain | Description | UniProt A B | Lysozyme | LYS_BPT4 1-175 1t97 mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 55 non- polymer residues more than 3.0 Angstroms away. Alignment of 1t97 chain B to query has RMSD 1.01 using 50 of 129 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l73 from http://files.rcsb.org/download/1l73.cif 1l73 title: Multiple stabilizing alanine replacements within α-helix 126-134 of T4 lysozyme have independent, additive effects on both structure and stability [more info...] Chain information for 1l73 #34 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l73 #34 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l73 chain A to query has RMSD 0.93 using 44 of 124 paired residues within cutoff distance 2.0 1epy title: T4 lysozyme mutant, T21H/C54T/C97A/Q141H/T142H [more info...] Chain information for 1epy #35 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1epy #35 --- CL — chloride ion CO — cobalt (II) ion SO4 — sulfate ion Deleted 9 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues more than 3.0 Angstroms away. Alignment of 1epy chain A to query has RMSD 0.924 using 45 of 127 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 168l from http://files.rcsb.org/download/168l.cif 168l title: Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme [more info...] Chain information for 168l #36 --- Chain | Description | UniProt A B C D E | T4 LYSOZYME | LYS_BPT4 1-164 168l mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 3| author_defined_assembly 4| author_defined_assembly 5| author_defined_assembly Deleted 4 extra chains, 11 C-terminal residues, 2 N-terminal residues. Alignment of 168l chain B to query has RMSD 1.18 using 67 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 6v51 from http://files.rcsb.org/download/6v51.cif Fetching CCD QPM from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/M/QPM/QPM.cif 6v51 title: Spin-labeled T4 Lysozyme (9/131FnbY)-(4-Amino-TEMPO) [more info...] Chain information for 6v51 #37 --- Chain | Description | UniProt A | Endolysin | D9IEF7_BPT4 1-164 Non-standard residues in 6v51 #37 --- QPM — 4-amino-2,2,6,6-tetramethylpiperidin-1-ol (4-Amino-TEMPO) 12 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 83 non-polymer residues more than 3.0 Angstroms away. Alignment of 6v51 chain A to query has RMSD 0.927 using 48 of 126 paired residues within cutoff distance 2.0 4arj title: Crystal structure of a pesticin (translocation and receptor binding domain) from Y. pestis and T4-lysozyme chimera [more info...] Chain information for 4arj #38 --- Chain | Description | UniProt A B | PESTICIN, LYSOZYME | Q57159_YERPE 1-167, LYS_BPT4 169-331 Non-standard residues in 4arj #38 --- SO4 — sulfate ion 4arj mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 11 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 5079 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 14 C-terminal residues, 137 N-terminal residues, 61 non-polymer residues more than 3.0 Angstroms away. Alignment of 4arj chain A to query has RMSD 0.987 using 54 of 136 paired residues within cutoff distance 2.0 2hum title: Crystal structure of T4 Lysozyme D72C synthetic dimer [more info...] Chain information for 2hum #39 --- Chain | Description | UniProt A B | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 2hum #39 --- TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer) Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 61 non- polymer residues more than 3.0 Angstroms away. Alignment of 2hum chain A to query has RMSD 0.953 using 49 of 125 paired residues within cutoff distance 2.0 1l26 title: Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter protein stability [more info...] Chain information for 1l26 #40 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l26 #40 --- BME — β-mercaptoethanol 1 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l26 chain A to query has RMSD 1.06 using 49 of 125 paired residues within cutoff distance 2.0 1l77 title: Design and structural analysis of alternative hydrophobic core packing arrangements In bacteriophage T4 lysozyme [more info...] Chain information for 1l77 #41 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l77 #41 --- BME — β-mercaptoethanol CL — chloride ion Deleted 7 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l77 chain A to query has RMSD 0.983 using 49 of 127 paired residues within cutoff distance 2.0 1l75 title: Multiple stabilizing alanine replacements within α-helix 126-134 of T4 lysozyme have independent, additive effects on both structure and stability [more info...] Chain information for 1l75 #42 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l75 #42 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l75 chain A to query has RMSD 0.852 using 42 of 127 paired residues within cutoff distance 2.0 175l title: Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme [more info...] Chain information for 175l #43 --- Chain | Description | UniProt A B | T4 LYSOZYME | LYS_BPT4 1-164 175l mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 58 non- polymer residues more than 3.0 Angstroms away. Alignment of 175l chain B to query has RMSD 0.922 using 46 of 127 paired residues within cutoff distance 2.0 145l title: Role of backbone flexibility In the accommodation of variants that repack the core of T4 lysozyme [more info...] Chain information for 145l #44 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 145l #44 --- BME — β-mercaptoethanol Deleted 9 C-terminal residues, 2 N-terminal residues, 34 non-polymer residues more than 3.0 Angstroms away. Alignment of 145l chain A to query has RMSD 0.931 using 49 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 6cm4 from http://files.rcsb.org/download/6cm4.cif Fetching CCD 8NU from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/U/8NU/8NU.cif Fetching CCD PEG from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/G/PEG/PEG.cif 6cm4 title: Structure of the D2 Dopamine Receptor Bound to the Atypical Antipsychotic Drug Risperidone [more info...] Chain information for 6cm4 #45 --- Chain | Description | UniProt A | D(2) dopamine receptor, endolysin chimera | DRD2_HUMAN 35-222 362-443, D9IEF7_BPT4 1002-1161 Non-standard residues in 6cm4 #45 --- 8NU — 3-[2-[4-(6-fluoranyl-1,2-benzoxazol-3-yl)piperidin-1-yl]ethyl]-2-methyl-6,7,8,9-tetrahydropyrido[1,2-a]pyrimidin-4-one OLA — oleic acid PEG — di(hydroxyethyl)ether 2991 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 87 C-terminal residues, 184 N-terminal residues, 21 non-polymer residues more than 3.0 Angstroms away. Alignment of 6cm4 chain A to query has RMSD 1.02 using 55 of 126 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 3g3x from http://files.rcsb.org/download/3g3x.cif 3g3x title: Crystal structure of spin labeled T4 Lysozyme (T151R1) at 100 K [more info...] Chain information for 3g3x #46 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3g3x #46 --- AZI — azide ion CL — chloride ion HED — 2-hydroxyethyl disulfide MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate (MTSL) 26 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues more than 3.0 Angstroms away. Alignment of 3g3x chain A to query has RMSD 0.973 using 49 of 126 paired residues within cutoff distance 2.0 1zyt title: Crystal structure of spin labeled T4 Lysozyme (A82R1) [more info...] Chain information for 1zyt #47 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 1zyt #47 --- AZI — azide ion CL — chloride ion HED — 2-hydroxyethyl disulfide MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate (MTSL) 17 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 104 non-polymer residues more than 3.0 Angstroms away. Alignment of 1zyt chain A to query has RMSD 0.98 using 50 of 124 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 3sb8 from http://files.rcsb.org/download/3sb8.cif 3sb8 title: Cu-mediated Dimer of T4 Lysozyme D61H/K65H by Synthetic Symmetrization [more info...] Chain information for 3sb8 #48 --- Chain | Description | UniProt A B C | Lysozyme | LYS_BPT4 1-162 Non-standard residues in 3sb8 #48 --- CU — copper (II) ion 3sb8 mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly Deleted 2 extra chains, 9 C-terminal residues, 5 N-terminal residues, 9 non- polymer residues more than 3.0 Angstroms away. Alignment of 3sb8 chain A to query has RMSD 0.981 using 49 of 127 paired residues within cutoff distance 2.0 238l title: The response of T4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect [more info...] Chain information for 238l #49 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 238l #49 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues more than 3.0 Angstroms away. Alignment of 238l chain A to query has RMSD 0.934 using 46 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1p46 from http://files.rcsb.org/download/1p46.cif 1p46 title: T4 lysozyme core repacking mutant M106I/TA [more info...] Chain information for 1p46 #50 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1p46 #50 --- CL — chloride ion HED — 2-hydroxyethyl disulfide K — potassium ion 24 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 116 non-polymer residues more than 3.0 Angstroms away. Alignment of 1p46 chain A to query has RMSD 0.99 using 52 of 125 paired residues within cutoff distance 2.0 1l65 title: Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A polyalanine α-helix containing ten consecutive alanines [more info...] Chain information for 1l65 #51 --- Chain | Description | UniProt A | LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l65 #51 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 53 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l65 chain A to query has RMSD 1.01 using 49 of 124 paired residues within cutoff distance 2.0 1g0k title: Crystal structure of T4 lysozyme mutant T152C [more info...] Chain information for 1g0k #52 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1g0k #52 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 11 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues more than 3.0 Angstroms away. Alignment of 1g0k chain A to query has RMSD 0.999 using 49 of 125 paired residues within cutoff distance 2.0 8gtm title: Corticotropin-releasing hormone receptor 1(CRF1R) bound with BMK-C203 by XFEL [more info...] Chain information for 8gtm #53 --- Chain | Description | UniProt A | Isoform CRF-R2 of Corticotropin-releasing factor receptor 1 | CRFR1_HUMAN 104-373 B | Endolysin | A0A346FJK3_BPT6 1000-1159 Non-standard residues in 8gtm #53 --- 0VI — 7-(4-bromanyl-2,6-dimethoxy- phenyl)-4,8-dimethyl-~{N},~{N}-bis[4,4,4-tris(fluoranyl)butyl]-1$l^{4},3,5,9-tetrazabicyclo[4.3.0]nona-1(6),2,4,8-tetraen-2-amine Deleted 1 extra chains, 8 C-terminal residues, 1 N-terminal residues, 1 non- polymer residues more than 3.0 Angstroms away. Alignment of 8gtm chain B to query has RMSD 1.28 using 69 of 126 paired residues within cutoff distance 2.0 3sba title: Zn-mediated Hexamer of T4 Lysozyme R76H/R80H by Synthetic Symmetrization [more info...] Chain information for 3sba #54 --- Chain | Description | UniProt A B C D E F | Lysozyme | LYS_BPT4 1-162 Non-standard residues in 3sba #54 --- CL — chloride ion ZN — zinc ion 7770 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 5 extra chains, 9 C-terminal residues, 3 N-terminal residues, 6 non- polymer residues more than 3.0 Angstroms away. Alignment of 3sba chain E to query has RMSD 1.35 using 57 of 127 paired residues within cutoff distance 2.0 3c8r title: Contributions of all 20 amino acids at site 96 to stability and structure of T4 lysozyme [more info...] Chain information for 3c8r #55 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3c8r #55 --- BME — β-mercaptoethanol CL — chloride ion 13 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 22 non-polymer residues more than 3.0 Angstroms away. Alignment of 3c8r chain A to query has RMSD 1 using 48 of 125 paired residues within cutoff distance 2.0 2ntg title: Structure of Spin-labeled T4 Lysozyme Mutant T115R7 [more info...] Chain information for 2ntg #56 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 2ntg #56 --- BME — β-mercaptoethanol R7A — S-[(4-bromo-1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate 253 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 11 C-terminal residues, 2 N-terminal residues, 122 non-polymer residues more than 3.0 Angstroms away. Alignment of 2ntg chain A to query has RMSD 0.999 using 50 of 124 paired residues within cutoff distance 2.0 1g06 title: Crystal structure of T4 lysozyme mutant V149S [more info...] Chain information for 1g06 #57 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1g06 #57 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues more than 3.0 Angstroms away. Alignment of 1g06 chain A to query has RMSD 0.994 using 48 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 177l from http://files.rcsb.org/download/177l.cif 177l title: Protein flexibility and adaptability seen in 25 crystal forms of T4 LYSOZYME [more info...] Chain information for 177l #58 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 9 C-terminal residues, 2 N-terminal residues, 3 non-polymer residues more than 3.0 Angstroms away. Alignment of 177l chain A to query has RMSD 0.986 using 46 of 125 paired residues within cutoff distance 2.0 122l title: The energetic cost and the structural consequences of burying A hydroxyl group within the core of A protein determined from ala to ser and val to THR substitutions In T4 lysozyme [more info...] Chain information for 122l #59 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 122l #59 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues more than 3.0 Angstroms away. Alignment of 122l chain A to query has RMSD 1.03 using 50 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 103l from http://files.rcsb.org/download/103l.cif 103l title: How amino-acid insertions are allowed In an α-helix of T4 lysozyme [more info...] Chain information for 103l #60 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 103l #60 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues more than 3.0 Angstroms away. Alignment of 103l chain A to query has RMSD 0.898 using 45 of 124 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 5kio from http://files.rcsb.org/download/5kio.cif 5kio title: Pseudo T4 lysozyme mutant - Y18PHE-I [more info...] Chain information for 5kio #61 --- Chain | Description | UniProt A | Endolysin | ENLYS_BPT4 1-164 Non-standard residues in 5kio #61 --- HED — 2-hydroxyethyl disulfide 75 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 9 C-terminal residues, 2 N-terminal residues, 133 non-polymer residues more than 3.0 Angstroms away. Alignment of 5kio chain A to query has RMSD 0.971 using 48 of 126 paired residues within cutoff distance 2.0 3pbl title: Structure of the human dopamine D3 receptor in complex with eticlopride [more info...] Chain information for 3pbl #62 --- Chain | Description | UniProt A B | D(3) dopamine receptor, Lysozyme chimera | DRD3_HUMAN 2-221 319-400, LYS_BPT4 1002-1161 Non-standard residues in 3pbl #62 --- ETQ — 3-chloro-5-ethyl-N-{[(2S)-1-ethylpyrrolidin-2-yl]methyl}-6-hydroxy-2-methoxybenzamide GLC — alpha-D-glucopyranose (alpha-D-glucose; D-glucose; glucose) 3pbl mmCIF Assemblies --- 1| software_defined_assembly 2| software_defined_assembly 6695 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 90 C-terminal residues, 191 N-terminal residues, 4 non-polymer residues more than 3.0 Angstroms away. Alignment of 3pbl chain A to query has RMSD 0.95 using 47 of 127 paired residues within cutoff distance 2.0 1p2l title: T4 Lysozyme Core Repacking Mutant V87I/TA [more info...] Chain information for 1p2l #63 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1p2l #63 --- CL — chloride ion HED — 2-hydroxyethyl disulfide K — potassium ion PO4 — phosphate ion 41 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 114 non-polymer residues more than 3.0 Angstroms away. Alignment of 1p2l chain A to query has RMSD 0.943 using 48 of 124 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l82 from http://files.rcsb.org/download/1l82.cif 1l82 title: Design and structural analysis of alternative hydrophobic core packing arrangements In bacteriophage T4 lysozyme [more info...] Chain information for 1l82 #64 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l82 #64 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l82 chain A to query has RMSD 1.01 using 48 of 124 paired residues within cutoff distance 2.0 1l36 title: Toward A simplification of the protein folding problem: A stabilizing polyalanine α-helix engineered In T4 lysozyme [more info...] Chain information for 1l36 #65 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l36 #65 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l36 chain A to query has RMSD 1.02 using 47 of 125 paired residues within cutoff distance 2.0 162l title: Control of enzyme activity by an engineered disulfide bond [more info...] Chain information for 162l #66 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 162l #66 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues more than 3.0 Angstroms away. Alignment of 162l chain A to query has RMSD 0.995 using 48 of 125 paired residues within cutoff distance 2.0 3pbl title: Structure of the human dopamine D3 receptor in complex with eticlopride [more info...] Chain information for 3pbl #67 --- Chain | Description | UniProt A B | D(3) dopamine receptor, Lysozyme chimera | DRD3_HUMAN 2-221 319-400, LYS_BPT4 1002-1161 Non-standard residues in 3pbl #67 --- ETQ — 3-chloro-5-ethyl-N-{[(2S)-1-ethylpyrrolidin-2-yl]methyl}-6-hydroxy-2-methoxybenzamide GLC — alpha-D-glucopyranose (alpha-D-glucose; D-glucose; glucose) 3pbl mmCIF Assemblies --- 1| software_defined_assembly 2| software_defined_assembly 6695 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 90 C-terminal residues, 167 N-terminal residues, 5 non-polymer residues more than 3.0 Angstroms away. Alignment of 3pbl chain B to query has RMSD 1 using 46 of 142 paired residues within cutoff distance 2.0 232l title: T4 lysozyme mutant M120K [more info...] Chain information for 232l #68 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 232l #68 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues more than 3.0 Angstroms away. Alignment of 232l chain A to query has RMSD 0.973 using 48 of 125 paired residues within cutoff distance 2.0 1tla title: Hydrophobic core repacking and aromatic-aromatic interaction In the thermostable mutant of T4 lysozyme ser 117 (right arrow) phe [more info...] Chain information for 1tla #69 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1tla #69 --- CL — chloride ion PO4 — phosphate ion Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues more than 3.0 Angstroms away. Alignment of 1tla chain A to query has RMSD 1.04 using 50 of 125 paired residues within cutoff distance 2.0 1g0g title: Crystal structure of T4 lysozyme mutant T152A [more info...] Chain information for 1g0g #70 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1g0g #70 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues more than 3.0 Angstroms away. Alignment of 1g0g chain A to query has RMSD 0.987 using 49 of 125 paired residues within cutoff distance 2.0 172l title: Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme [more info...] Chain information for 172l #71 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 172l #71 --- BME — β-mercaptoethanol Deleted 11 C-terminal residues, 2 N-terminal residues, 20 non-polymer residues more than 3.0 Angstroms away. Alignment of 172l chain A to query has RMSD 1.26 using 69 of 124 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 5w0p from http://files.rcsb.org/download/5w0p.cif 5w0p title: Crystal structure of rhodopsin bound to visual arrestin determined by X-ray free electron laser [more info...] Chain information for 5w0p #72 --- Chain | Description | UniProt A B C D | Endolysin,Rhodopsin,S-arrestin | A0A097J792_BPT4 -159-0, OPSD_HUMAN 1-1994, ARRS_MOUSE 2010-2392 Non-standard residues in 5w0p #72 --- NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE) 5w0p mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 3| author_defined_assembly 4| author_defined_assembly 25976 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 3 extra chains, 698 C-terminal residues, 8 non-polymer residues more than 3.0 Angstroms away. Alignment of 5w0p chain C to query has RMSD 1.33 using 53 of 126 paired residues within cutoff distance 2.0 1l72 title: Multiple stabilizing alanine replacements within α-helix 126-134 of T4 lysozyme have independent, additive effects on both structure and stability [more info...] Chain information for 1l72 #73 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l72 #73 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l72 chain A to query has RMSD 0.89 using 44 of 125 paired residues within cutoff distance 2.0 1i6s title: T4 lysozyme mutant C54T/C97A/N101A [more info...] Chain information for 1i6s #74 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1i6s #74 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues more than 3.0 Angstroms away. Alignment of 1i6s chain A to query has RMSD 1.04 using 50 of 125 paired residues within cutoff distance 2.0 1g0p title: Crystal structure of T4 lysozyme mutant V149G [more info...] Chain information for 1g0p #75 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1g0p #75 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues more than 3.0 Angstroms away. Alignment of 1g0p chain A to query has RMSD 1.02 using 48 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 167l from http://files.rcsb.org/download/167l.cif 167l title: Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme [more info...] Chain information for 167l #76 --- Chain | Description | UniProt A B | T4 LYSOZYME | LYS_BPT4 1-163 167l mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 28 non- polymer residues more than 3.0 Angstroms away. Alignment of 167l chain A to query has RMSD 1.02 using 48 of 125 paired residues within cutoff distance 2.0 146l title: Role of backbone flexibility In the accommodation of variants that repack the core of T4 lysozyme [more info...] Chain information for 146l #77 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 146l #77 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues more than 3.0 Angstroms away. Alignment of 146l chain A to query has RMSD 0.981 using 47 of 127 paired residues within cutoff distance 2.0 5kii title: Pseudo T4 lysozyme mutant - Y88PHE-methyl [more info...] Chain information for 5kii #78 --- Chain | Description | UniProt A | Endolysin | ENLYS_BPT4 1-164 Non-standard residues in 5kii #78 --- HED — 2-hydroxyethyl disulfide PO4 — phosphate ion 101 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Hit structure sequence 5kii_A amino acid F at sequence position 87 does not match sequence alignment D at position 85. Structure sequence MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVFDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNLHHHHHH. Alignment sequence IFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTF. Deleted 10 C-terminal residues, 2 N-terminal residues, 186 non-polymer residues more than 3.0 Angstroms away. Alignment of 5kii chain A to query has RMSD 1.21 using 25 of 124 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 4yc4 from http://files.rcsb.org/download/4yc4.cif Fetching CCD M59 from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/9/M59/M59.cif 4yc4 title: Crystal structure of phosphatidyl inositol 4-kinase II α in complex with nucleotide analog [more info...] Chain information for 4yc4 #79 --- Chain | Description | UniProt A | Phosphatidylinositol 4-kinase type 2-alpha,Lysozyme,Phosphatidylinositol 4-kinase type 2-alpha | P4K2A_HUMAN 76-172 180-468, D9IEF7_BPT4 1004-1166 Non-standard residues in 4yc4 #79 --- ADP — adenosine-5'-diphosphate M59 — [(1S,3S,4S)-3-(6-amino-9H-purin-9-yl)bicyclo[2.2.1]hept-1-yl]methanol Deleted 259 C-terminal residues, 73 N-terminal residues, 5 non-polymer residues more than 3.0 Angstroms away. Alignment of 4yc4 chain A to query has RMSD 0.805 using 43 of 129 paired residues within cutoff distance 2.0 3l64 title: T4 Lysozyme S44E/WT* [more info...] Chain information for 3l64 #80 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3l64 #80 --- BME — β-mercaptoethanol Deleted 11 C-terminal residues, 2 N-terminal residues, 37 non-polymer residues more than 3.0 Angstroms away. Alignment of 3l64 chain A to query has RMSD 0.93 using 45 of 127 paired residues within cutoff distance 2.0 237l title: The response of T4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect [more info...] Chain information for 237l #81 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 237l #81 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 11 C-terminal residues, 2 N-terminal residues, 81 non-polymer residues more than 3.0 Angstroms away. Alignment of 237l chain A to query has RMSD 1.02 using 49 of 125 paired residues within cutoff distance 2.0 1l67 title: Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A polyalanine α-helix containing ten consecutive alanines [more info...] Chain information for 1l67 #82 --- Chain | Description | UniProt A | LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l67 #82 --- BME — β-mercaptoethanol CL — chloride ion Deleted 7 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l67 chain A to query has RMSD 0.972 using 48 of 127 paired residues within cutoff distance 2.0 1l53 title: Structural and thermodynamic analysis of the packing of two α-helices In bacteriophage T4 lysozyme [more info...] Chain information for 1l53 #83 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l53 #83 --- BME — β-mercaptoethanol Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l53 chain A to query has RMSD 0.877 using 44 of 125 paired residues within cutoff distance 2.0 1l40 title: Contributions of engineered surface salt bridges to the stability of T4 lysozyme determined by directed mutagenesis [more info...] Chain information for 1l40 #84 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l40 chain A to query has RMSD 0.936 using 46 of 125 paired residues within cutoff distance 2.0 1l18 title: Hydrophobic stabilization In T4 lysozyme determined directly by multiple substitutions of ile 3 [more info...] Chain information for 1l18 #85 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l18 chain A to query has RMSD 1.02 using 49 of 125 paired residues within cutoff distance 2.0 155l title: Control of enzyme activity by an engineered disulfide bond [more info...] Chain information for 155l #86 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 155l #86 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues more than 3.0 Angstroms away. Alignment of 155l chain A to query has RMSD 1.01 using 48 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 152l from http://files.rcsb.org/download/152l.cif 152l title: Conservation of solvent-binding sites In 10 crystal forms of T4 lysozyme [more info...] Chain information for 152l #87 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-163 Non-standard residues in 152l #87 --- SO4 — sulfate ion Deleted 11 C-terminal residues, 2 N-terminal residues, 22 non-polymer residues more than 3.0 Angstroms away. Alignment of 152l chain A to query has RMSD 0.866 using 42 of 127 paired residues within cutoff distance 2.0 Atom D1 is not in the residue template for MET /A:1 Atom D is not in the residue template for ASN /A:2 Atom D is not in the residue template for ILE /A:3 Atom D is not in the residue template for PHE /A:4 Atom D is not in the residue template for GLU /A:5 Atom D is not in the residue template for ALA /A:6 Atom D is not in the residue template for LEU /A:7 Atom D is not in the residue template for ARG /A:8 Atom D is not in the residue template for ILE /A:9 Too many hydrogens missing from residue template(s) to warn about 6u0e title: Neutron crystal structure of T4L M6AE [more info...] Chain information for 6u0e #88 --- Chain | Description | UniProt A | Endolysin | D9IEF7_BPT4 1-164 664 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues. Alignment of 6u0e chain A to query has RMSD 1.03 using 48 of 126 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 6u0c from http://files.rcsb.org/download/6u0c.cif Atom D1 is not in the residue template for MET /A:1 Atom D is not in the residue template for ASN /A:2 Atom D is not in the residue template for ILE /A:3 Atom D is not in the residue template for PHE /A:4 Atom D is not in the residue template for GLU /A:5 Atom D is not in the residue template for MET /A:6 Atom D is not in the residue template for LEU /A:7 Atom D is not in the residue template for ARG /A:8 Atom D is not in the residue template for ILE /A:9 Too many hydrogens missing from residue template(s) to warn about 6u0c title: Neutron crystal structure of wtT4LE [more info...] Chain information for 6u0c #89 --- Chain | Description | UniProt A | Endolysin | D9IEF7_BPT4 1-164 Non-standard residues in 6u0c #89 --- CL — chloride ion 656 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 1 non-polymer residues more than 3.0 Angstroms away. Alignment of 6u0c chain A to query has RMSD 0.988 using 48 of 126 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 4djh from http://files.rcsb.org/download/4djh.cif Fetching CCD JDC from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/C/JDC/JDC.cif 4djh title: Structure of the human κ opioid receptor in complex with JDTic [more info...] Chain information for 4djh #90 --- Chain | Description | UniProt A B | Kappa-type opioid receptor, Lysozyme | OPRK_HUMAN 43-261 263-358, LYS_BPT4 1002-1161 Non-standard residues in 4djh #90 --- CIT — citric acid JDC — (3R)-7-hydroxy-N-{(2S)-1-[(3R,4R)-4-(3-hydroxyphenyl)-3,4-dimethylpiperidin-1-yl]-3-methylbutan-2-yl}-1,2,3,4-tetrahydroisoquinoline-3-carboxamide OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) PEG — di(hydroxyethyl)ether 4djh mmCIF Assemblies --- 1| software_defined_assembly 2| software_defined_assembly 6932 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 88 C-terminal residues, 192 N-terminal residues, 29 non-polymer residues more than 3.0 Angstroms away. Alignment of 4djh chain A to query has RMSD 1.34 using 54 of 141 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 3fa0 from http://files.rcsb.org/download/3fa0.cif 3fa0 title: Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the Temperature Sensitive T4 Lysozyme Mutant Arg96-->His [more info...] Chain information for 3fa0 #91 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-162 Non-standard residues in 3fa0 #91 --- BME — β-mercaptoethanol CL — chloride ion HED — 2-hydroxyethyl disulfide K — potassium ion PO4 — phosphate ion 37 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 1528 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 9 C-terminal residues, 2 N-terminal residues, 103 non-polymer residues more than 3.0 Angstroms away. Alignment of 3fa0 chain A to query has RMSD 0.991 using 50 of 125 paired residues within cutoff distance 2.0 2ray title: beta-chlorophenetole in complex with T4 lysozyme L99A [more info...] Chain information for 2ray #92 --- Chain | Description | UniProt X | Lysozyme | LYS_BPT4 1-162 Non-standard residues in 2ray #92 --- 258 — (2-chloroethoxy)benzene PO4 — phosphate ion 6 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 9 C-terminal residues, 2 N-terminal residues, 93 non-polymer residues more than 3.0 Angstroms away. Alignment of 2ray chain X to query has RMSD 0.931 using 48 of 124 paired residues within cutoff distance 2.0 260l title: AN adaptable metal-binding site engineered INTO T4 lysozyme [more info...] Chain information for 260l #93 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 260l #93 --- CL — chloride ion NI — nickel (II) ion Deleted 9 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues more than 3.0 Angstroms away. Alignment of 260l chain A to query has RMSD 0.86 using 43 of 126 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l86 from http://files.rcsb.org/download/1l86.cif 1l86 title: Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4 lysozyme have different structural and thermodynamic consequences [more info...] Chain information for 1l86 #94 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l86 #94 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l86 chain A to query has RMSD 0.866 using 46 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 7z36 from http://files.rcsb.org/download/7z36.cif 7z36 title: Crystal structure of the KAP1 tripartite motif in complex with the ZNF93 KRAB domain [more info...] Chain information for 7z36 #95 --- Chain | Description | UniProt A B | Endolysin,Transcription intermediary factor 1-beta,Isoform 2 of Transcription intermediary factor 1-beta | ENLYS_BPT4 26-185, TIF1B_HUMAN 187-271, TIF1B-2_HUMAN 272-482 C S | SMARCAD1 CUE1 domain | D | Zinc finger protein 93 | ZNF93_HUMAN 2-71 Non-standard residues in 7z36 #95 --- ZN — zinc ion 7889 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 4 extra chains, 272 C-terminal residues, 8 non-polymer residues more than 3.0 Angstroms away. Alignment of 7z36 chain A to query has RMSD 0.913 using 46 of 134 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 6pgy from http://files.rcsb.org/download/6pgy.cif 6pgy title: MTSL labelled T4 lysozyme pseudo-wild type K65C mutant [more info...] Chain information for 6pgy #96 --- Chain | Description | UniProt A | Endolysin | D9IEF7_BPT4 1-164 Non-standard residues in 6pgy #96 --- CL — chloride ion HED — 2-hydroxyethyl disulfide MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate (MTSL) 41 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 9 C-terminal residues, 2 N-terminal residues, 32 non-polymer residues more than 3.0 Angstroms away. Alignment of 6pgy chain A to query has RMSD 0.98 using 47 of 126 paired residues within cutoff distance 2.0 254l title: Lysozyme [more info...] Chain information for 254l #97 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 254l #97 --- BME — β-mercaptoethanol CL — chloride ion Deleted 11 C-terminal residues, 2 N-terminal residues, 84 non-polymer residues more than 3.0 Angstroms away. Alignment of 254l chain A to query has RMSD 0.98 using 48 of 125 paired residues within cutoff distance 2.0 213l title: Protein structure plasticity exemplified by insertion and deletion mutants In T4 lysozyme [more info...] Chain information for 213l #98 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 9 C-terminal residues, 2 N-terminal residues, 46 non-polymer residues more than 3.0 Angstroms away. Alignment of 213l chain A to query has RMSD 0.987 using 48 of 125 paired residues within cutoff distance 2.0 1l88 title: Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4 lysozyme have different structural and thermodynamic consequences [more info...] Chain information for 1l88 #99 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l88 #99 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l88 chain A to query has RMSD 1.07 using 50 of 125 paired residues within cutoff distance 2.0 114l title: Structural basis of α-helix propensity At two sites In T4 lysozyme [more info...] Chain information for 114l #100 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 114l #100 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues more than 3.0 Angstroms away. Alignment of 114l chain A to query has RMSD 1 using 48 of 125 paired residues within cutoff distance 2.0 102l title: How amino-acid insertions are allowed In an α-helix of T4 lysozyme [more info...] Chain information for 102l #101 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 102l #101 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues more than 3.0 Angstroms away. Alignment of 102l chain A to query has RMSD 1 using 48 of 125 paired residues within cutoff distance 2.0 4djh title: Structure of the human κ opioid receptor in complex with JDTic [more info...] Chain information for 4djh #102 --- Chain | Description | UniProt A B | Kappa-type opioid receptor, Lysozyme | OPRK_HUMAN 43-261 263-358, LYS_BPT4 1002-1161 Non-standard residues in 4djh #102 --- CIT — citric acid JDC — (3R)-7-hydroxy-N-{(2S)-1-[(3R,4R)-4-(3-hydroxyphenyl)-3,4-dimethylpiperidin-1-yl]-3-methylbutan-2-yl}-1,2,3,4-tetrahydroisoquinoline-3-carboxamide OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) PEG — di(hydroxyethyl)ether 4djh mmCIF Assemblies --- 1| software_defined_assembly 2| software_defined_assembly 6932 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 88 C-terminal residues, 199 N-terminal residues, 30 non-polymer residues more than 3.0 Angstroms away. Alignment of 4djh chain B to query has RMSD 0.918 using 47 of 134 paired residues within cutoff distance 2.0 3fad title: Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the Temperature Sensitive T4 Lysozyme Mutant Arg96-->His [more info...] Chain information for 3fad #103 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3fad #103 --- BME — β-mercaptoethanol PO4 — phosphate ion 3fad mmCIF Assemblies --- 1| author_defined_assembly 2| software_defined_assembly 72 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 1525 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 11 C-terminal residues, 2 N-terminal residues, 103 non-polymer residues more than 3.0 Angstroms away. Alignment of 3fad chain A to query has RMSD 0.971 using 46 of 122 paired residues within cutoff distance 2.0 1qt6 title: E11H Mutant of T4 Lysozyme [more info...] Chain information for 1qt6 #104 --- Chain | Description | UniProt A | PROTEIN (T4 LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1qt6 #104 --- BME — β-mercaptoethanol CL — chloride ion Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues more than 3.0 Angstroms away. Alignment of 1qt6 chain A to query has RMSD 1.07 using 50 of 125 paired residues within cutoff distance 2.0 1qs9 title: The introduction of strain and its effects on the structure and stability of T4 lysozyme [more info...] Chain information for 1qs9 #105 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-162 Deleted 9 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues more than 3.0 Angstroms away. Alignment of 1qs9 chain A to query has RMSD 1.06 using 49 of 125 paired residues within cutoff distance 2.0 1p36 title: T4 lyoszyme core repacking mutant I100V/Ta [more info...] Chain information for 1p36 #106 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1p36 #106 --- BME — β-mercaptoethanol CL — chloride ion K — potassium ion 14 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 104 non-polymer residues more than 3.0 Angstroms away. Alignment of 1p36 chain A to query has RMSD 0.987 using 50 of 124 paired residues within cutoff distance 2.0 1l32 title: Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter protein stability [more info...] Chain information for 1l32 #107 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l32 chain A to query has RMSD 1.02 using 48 of 127 paired residues within cutoff distance 2.0 5w0p title: Crystal structure of rhodopsin bound to visual arrestin determined by X-ray free electron laser [more info...] Chain information for 5w0p #108 --- Chain | Description | UniProt A B C D | Endolysin,Rhodopsin,S-arrestin | A0A097J792_BPT4 -159-0, OPSD_HUMAN 1-1994, ARRS_MOUSE 2010-2392 Non-standard residues in 5w0p #108 --- NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE) 5w0p mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 3| author_defined_assembly 4| author_defined_assembly 25976 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 3 extra chains, 697 C-terminal residues, 8 non-polymer residues more than 3.0 Angstroms away. Alignment of 5w0p chain A to query has RMSD 0.939 using 41 of 126 paired residues within cutoff distance 2.0 3cdv title: Contributions of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme [more info...] Chain information for 3cdv #109 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3cdv #109 --- BME — β-mercaptoethanol CL — chloride ion 38 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues more than 3.0 Angstroms away. Alignment of 3cdv chain A to query has RMSD 1 using 49 of 125 paired residues within cutoff distance 2.0 201l title: How amino-acid insertions are allowed In an α-helix of T4 lysozyme [more info...] Chain information for 201l #110 --- Chain | Description | UniProt A B | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 201l #110 --- BME — β-mercaptoethanol 201l mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 94 non- polymer residues more than 3.0 Angstroms away. Alignment of 201l chain A to query has RMSD 0.907 using 46 of 125 paired residues within cutoff distance 2.0 1c6n title: T4 lysozyme mutant C54T/C97A/L99A/F153A In the presence of 8 atm xenon [more info...] Chain information for 1c6n #111 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164 Non-standard residues in 1c6n #111 --- BME — β-mercaptoethanol CL — chloride ion XE — XENON Deleted 10 C-terminal residues, 2 N-terminal residues, 51 non-polymer residues more than 3.0 Angstroms away. Alignment of 1c6n chain A to query has RMSD 1.01 using 50 of 124 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 5t04 from http://files.rcsb.org/download/5t04.cif Fetching CCD TCE from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/E/TCE/TCE.cif 5t04 title: Structure of constitutively active neurotensin receptor [more info...] Chain information for 5t04 #112 --- Chain | Description | UniProt A | Neurotensin receptor type 1,Endolysin,Neurotensin receptor type 1 | NTR1_RAT 43-268 297-396, ENLYS_BPT4 1002-1161 B | ARG-ARG-PRO-TYR-ILE-LEU | Non-standard residues in 5t04 #112 --- GOL — glycerol (glycerin; propane-1,2,3-triol) PEG — di(hydroxyethyl)ether TCE — 3,3',3''-phosphanetriyltripropanoic acid (3-[bis(2-carboxyethyl)phosphanyl]propanoic acid) 3703 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 88 C-terminal residues, 215 N-terminal residues, 4 non-polymer residues more than 3.0 Angstroms away. Alignment of 5t04 chain A to query has RMSD 1.24 using 57 of 129 paired residues within cutoff distance 2.0 1g0j title: Crystal structure of T4 lysozyme mutant T152S [more info...] Chain information for 1g0j #113 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1g0j #113 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues more than 3.0 Angstroms away. Alignment of 1g0j chain A to query has RMSD 1 using 49 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 4pla from http://files.rcsb.org/download/4pla.cif 4pla title: Crystal structure of phosphatidyl inositol 4-kinase II α in complex with ATP [more info...] Chain information for 4pla #114 --- Chain | Description | UniProt A | Chimera protein of Phosphatidylinositol 4-kinase type 2-alpha and Lysozyme | P4K2A_HUMAN 76-172 180-468, D9IEF7_BPT4 1004-1166 Non-standard residues in 4pla #114 --- ATP — adenosine-5'-triphosphate Deleted 256 C-terminal residues, 73 N-terminal residues, 3 non-polymer residues more than 3.0 Angstroms away. Alignment of 4pla chain A to query has RMSD 0.787 using 42 of 129 paired residues within cutoff distance 2.0 2ou9 title: Structure of Spin-labeled T4 Lysozyme Mutant T115R1/R119A [more info...] Chain information for 2ou9 #115 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 2ou9 #115 --- MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate (MTSL) Deleted 11 C-terminal residues, 2 N-terminal residues. Alignment of 2ou9 chain A to query has RMSD 0.947 using 48 of 124 paired residues within cutoff distance 2.0 1qt3 title: T26D mutant of T4 lysozyme [more info...] Chain information for 1qt3 #116 --- Chain | Description | UniProt A | PROTEIN (T4 Lysozyme) | LYS_BPT4 1-164 Non-standard residues in 1qt3 #116 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 11 C-terminal residues, 2 N-terminal residues, 87 non-polymer residues more than 3.0 Angstroms away. Alignment of 1qt3 chain A to query has RMSD 1.02 using 49 of 125 paired residues within cutoff distance 2.0 1qsb title: The introduction of strain and its effects on the structure and stability of T4 lysozyme [more info...] Chain information for 1qsb #117 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162 Non-standard residues in 1qsb #117 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues more than 3.0 Angstroms away. Alignment of 1qsb chain A to query has RMSD 1.03 using 49 of 125 paired residues within cutoff distance 2.0 1l74 title: Multiple stabilizing alanine replacements within α-helix 126-134 of T4 lysozyme have independent, additive effects on both structure and stability [more info...] Chain information for 1l74 #118 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l74 #118 --- BME — β-mercaptoethanol CL — chloride ion 5 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l74 chain A to query has RMSD 1.02 using 47 of 125 paired residues within cutoff distance 2.0 1l01 title: Structural studies of mutants of the lysozyme of bacteriophage T4. The temperature-sensitive mutant protein THR157 (right arrow) ile [more info...] Chain information for 1l01 #119 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l01 chain A to query has RMSD 1.04 using 49 of 124 paired residues within cutoff distance 2.0 1cv6 title: T4 lysozyme mutant V149M [more info...] Chain information for 1cv6 #120 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1cv6 #120 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues more than 3.0 Angstroms away. Alignment of 1cv6 chain A to query has RMSD 1.06 using 50 of 127 paired residues within cutoff distance 2.0 197l title: Thermodynamic and structural compensation In ""size-switch"" core-repacking variants of T4 lysozyme [more info...] Chain information for 197l #121 --- Chain | Description | UniProt A | LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 197l #121 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 42 non-polymer residues more than 3.0 Angstroms away. Alignment of 197l chain A to query has RMSD 0.939 using 48 of 127 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 110l from http://files.rcsb.org/download/110l.cif 110l title: Structural basis of α-helix propensity At two sites In T4 lysozyme [more info...] Chain information for 110l #122 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 110l #122 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues more than 3.0 Angstroms away. Alignment of 110l chain A to query has RMSD 0.928 using 46 of 125 paired residues within cutoff distance 2.0 2hul title: Crystal structure of T4 Lysozyme S44C synthetic dimer [more info...] Chain information for 2hul #123 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 2hul #123 --- GOL — glycerol (glycerin; propane-1,2,3-triol) SO4 — sulfate ion 2hul mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| software_defined_assembly 24 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues more than 3.0 Angstroms away. Alignment of 2hul chain A to query has RMSD 0.833 using 45 of 126 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l55 from http://files.rcsb.org/download/1l55.cif 1l55 title: Analysis of the interaction between charged side chains and the α-helix dipole using designed thermostable mutants of phage T4 lysozyme [more info...] Chain information for 1l55 #124 --- Chain | Description | UniProt A | LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l55 #124 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l55 chain A to query has RMSD 0.894 using 45 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1d3n from http://files.rcsb.org/download/1d3n.cif 1d3n title: Methionine core mutation [more info...] Chain information for 1d3n #125 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1d3n #125 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 49 non-polymer residues more than 3.0 Angstroms away. Alignment of 1d3n chain A to query has RMSD 0.883 using 44 of 125 paired residues within cutoff distance 2.0 3c81 title: Mutant K85A of T4 lysozyme in wildtype background at room temperature [more info...] Chain information for 3c81 #126 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3c81 #126 --- BME — β-mercaptoethanol CL — chloride ion 36 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 47 non-polymer residues more than 3.0 Angstroms away. Alignment of 3c81 chain A to query has RMSD 0.984 using 47 of 125 paired residues within cutoff distance 2.0 3c7y title: Mutant R96A OF T4 lysozyme in wildtype background at 298K [more info...] Chain information for 3c7y #127 --- Chain | Description | UniProt A | lysozyme | LYS_BPT4 1-164 Non-standard residues in 3c7y #127 --- BME — β-mercaptoethanol CL — chloride ion 23 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 21 non-polymer residues more than 3.0 Angstroms away. Alignment of 3c7y chain A to query has RMSD 0.972 using 47 of 124 paired residues within cutoff distance 2.0 206l title: Phage T4 lysozyme [more info...] Chain information for 206l #128 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 206l #128 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues more than 3.0 Angstroms away. Alignment of 206l chain A to query has RMSD 1.02 using 49 of 127 paired residues within cutoff distance 2.0 1pqd title: T4 lysozyme core repacking mutant CORE10/Ta [more info...] Chain information for 1pqd #129 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 1pqd #129 --- BME — β-mercaptoethanol CL — chloride ion K — potassium ion 11 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 103 non-polymer residues more than 3.0 Angstroms away. Alignment of 1pqd chain A to query has RMSD 1.21 using 51 of 124 paired residues within cutoff distance 2.0 1l48 title: Structural and thermodynamic analysis of the packing of two α-helices In bacteriophage T4 lysozyme [more info...] Chain information for 1l48 #130 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l48 #130 --- BME — β-mercaptoethanol Deleted 11 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l48 chain A to query has RMSD 1.01 using 47 of 125 paired residues within cutoff distance 2.0 1jtm title: Alternative Structures of a Sequence Extended T4 Lysozyme Show that the Highly Conserved Beta-Sheet has Weak Intrinsic Folding Propensity [more info...] Chain information for 1jtm #131 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1jtm #131 --- BME — β-mercaptoethanol Deleted 17 C-terminal residues, 2 N-terminal residues, 1 non-polymer residues more than 3.0 Angstroms away. Alignment of 1jtm chain A to query has RMSD 1.02 using 50 of 129 paired residues within cutoff distance 2.0 1cv3 title: T4 lysozyme mutant L121M [more info...] Chain information for 1cv3 #132 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1cv3 #132 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues more than 3.0 Angstroms away. Alignment of 1cv3 chain A to query has RMSD 0.997 using 48 of 125 paired residues within cutoff distance 2.0 147l title: Role of backbone flexibility In the accommodation of variants that repack the core of T4 lysozyme [more info...] Chain information for 147l #133 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 147l #133 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 54 non-polymer residues more than 3.0 Angstroms away. Alignment of 147l chain A to query has RMSD 1.04 using 51 of 124 paired residues within cutoff distance 2.0 7lx8 title: T4 lysozyme mutant L99A [more info...] Chain information for 7lx8 #134 --- Chain | Description | UniProt A | Lysozyme | D9IEF7_BPT4 1-164 Non-standard residues in 7lx8 #134 --- TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer) YGV — 1-chloro-2-(methylsulfanyl)benzene 27 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 9 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues more than 3.0 Angstroms away. Alignment of 7lx8 chain A to query has RMSD 0.995 using 47 of 125 paired residues within cutoff distance 2.0 4w56 title: T4 Lysozyme L99A with sec-Butylbenzene Bound [more info...] Chain information for 4w56 #135 --- Chain | Description | UniProt A | Endolysin | ENLYS_BPT4 1-164 Non-standard residues in 4w56 #135 --- 3GY — (2R)-butan-2-ylbenzene (sec-Butylbenzene) EPE — 4-(2-hydroxyethyl)-1-piperazine ethanesulfonic acid (HEPES) 132 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 47 non-polymer residues more than 3.0 Angstroms away. Alignment of 4w56 chain A to query has RMSD 0.904 using 43 of 124 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 3sbb from http://files.rcsb.org/download/3sbb.cif 3sbb title: Disulphide-mediated Tetramer of T4 Lysozyme R76C/R80C by Synthetic Symmetrization [more info...] Chain information for 3sbb #136 --- Chain | Description | UniProt C | Lysozyme | LYS_BPT4 1-162 Non-standard residues in 3sbb #136 --- CL — chloride ion 3sbb mmCIF Assemblies --- 1| author_and_software_defined_assembly 38 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 1527 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 9 C-terminal residues, 3 N-terminal residues, 117 non-polymer residues more than 3.0 Angstroms away. Alignment of 3sbb chain C to query has RMSD 1.26 using 61 of 124 paired residues within cutoff distance 2.0 3c82 title: Bacteriophage lysozyme T4 lysozyme mutant K85A/R96H [more info...] Chain information for 3c82 #137 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3c82 #137 --- BME — β-mercaptoethanol CL — chloride ion 33 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues more than 3.0 Angstroms away. Alignment of 3c82 chain A to query has RMSD 1.02 using 48 of 125 paired residues within cutoff distance 2.0 1qud title: L99G mutant of T4 lysozyme [more info...] Chain information for 1qud #138 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162 Non-standard residues in 1qud #138 --- CL — chloride ion HEZ — hexane-1,6-diol Deleted 9 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues more than 3.0 Angstroms away. Alignment of 1qud chain A to query has RMSD 0.961 using 46 of 127 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1p2r from http://files.rcsb.org/download/1p2r.cif 1p2r title: T4 lysozyme core repacking mutant I78V/Ta [more info...] Chain information for 1p2r #139 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1p2r #139 --- CL — chloride ion HED — 2-hydroxyethyl disulfide K — potassium ion 12 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 90 non-polymer residues more than 3.0 Angstroms away. Alignment of 1p2r chain A to query has RMSD 0.971 using 49 of 127 paired residues within cutoff distance 2.0 1l97 title: Structure of A hinge-bending bacteriophage T4 lysozyme mutant, ILE3-> pro [more info...] Chain information for 1l97 #140 --- Chain | Description | UniProt A B | T4 LYSOZYME | LYS_BPT4 1-164 1l97 mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 160 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l97 chain B to query has RMSD 1.18 using 53 of 122 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l95 from http://files.rcsb.org/download/1l95.cif 1l95 title: Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4 lysozyme have different structural and thermodynamic consequences [more info...] Chain information for 1l95 #141 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l95 #141 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l95 chain A to query has RMSD 0.846 using 45 of 126 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l85 from http://files.rcsb.org/download/1l85.cif 1l85 title: Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4 lysozyme have different structural and thermodynamic consequences [more info...] Chain information for 1l85 #142 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l85 #142 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l85 chain A to query has RMSD 0.902 using 45 of 126 paired residues within cutoff distance 2.0 1jtn title: Alternative Structures of a Sequence Extended T4 Lysozyme Show that the Highly Conserved Beta-Sheet Region has weak intrinsic Folding Propensity [more info...] Chain information for 1jtn #143 --- Chain | Description | UniProt A B | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1jtn #143 --- SO4 — sulfate ion 1jtn mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 1 extra chains, 24 C-terminal residues, 2 N-terminal residues, 112 non-polymer residues more than 3.0 Angstroms away. Alignment of 1jtn chain A to query has RMSD 0.962 using 47 of 125 paired residues within cutoff distance 2.0 1g0l title: Crystal structure of T4 lysozyme mutant T152V [more info...] Chain information for 1g0l #144 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1g0l #144 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 11 C-terminal residues, 2 N-terminal residues, 91 non-polymer residues more than 3.0 Angstroms away. Alignment of 1g0l chain A to query has RMSD 1.01 using 49 of 124 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1d9w from http://files.rcsb.org/download/1d9w.cif 1d9w title: Bacteriophage T4 lysozyme mutant [more info...] Chain information for 1d9w #145 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1d9w #145 --- BME — β-mercaptoethanol Deleted 9 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues more than 3.0 Angstroms away. Alignment of 1d9w chain A to query has RMSD 0.959 using 46 of 127 paired residues within cutoff distance 2.0 1c6i title: T4 lysozyme mutant C54T/C97A/L99A In the presence of 8 atm argon [more info...] Chain information for 1c6i #146 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164 Non-standard residues in 1c6i #146 --- AR — ARGON BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues more than 3.0 Angstroms away. Alignment of 1c6i chain A to query has RMSD 0.998 using 48 of 125 paired residues within cutoff distance 2.0 125l title: The energetic cost and the structural consequences of burying A hydroxyl group within the core of A protein determined from ala to ser and val to THR substitutions In T4 lysozyme [more info...] Chain information for 125l #147 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 125l #147 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues more than 3.0 Angstroms away. Alignment of 125l chain A to query has RMSD 1.04 using 50 of 124 paired residues within cutoff distance 2.0 108l title: Structural basis of α-helix propensity At two sites In T4 lysozyme [more info...] Chain information for 108l #148 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 108l #148 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 81 non-polymer residues more than 3.0 Angstroms away. Alignment of 108l chain A to query has RMSD 0.942 using 47 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 5v86 from http://files.rcsb.org/download/5v86.cif Fetching CCD 8ZA from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/A/8ZA/8ZA.cif 5v86 title: Structure of DCN1 bound to NAcM-OPT [more info...] Chain information for 5v86 #149 --- Chain | Description | UniProt A | Lysozyme,DCN1-like protein 1 | D9IEF7_BPT4 1-164, DCNL1_HUMAN 1062-1259 Non-standard residues in 5v86 #149 --- 8ZA — N-benzyl-N-(1-butylpiperidin-4-yl)-N'-(3,4-dichlorophenyl)urea 48 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 2932 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 196 C-terminal residues, 13 N-terminal residues, 428 non-polymer residues more than 3.0 Angstroms away. Alignment of 5v86 chain A to query has RMSD 1.29 using 76 of 124 paired residues within cutoff distance 2.0 1l93 title: Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4 lysozyme have different structural and thermodynamic consequences [more info...] Chain information for 1l93 #150 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l93 #150 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 53 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l93 chain A to query has RMSD 1.08 using 50 of 124 paired residues within cutoff distance 2.0 1l35 title: Structure of A thermostable disulfide-bridge mutant of phage T4 lysozyme shows that an engineered crosslink In A flexible region does not increase the rigidity of the folded protein [more info...] Chain information for 1l35 #151 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-163 Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l35 chain A to query has RMSD 1.02 using 49 of 124 paired residues within cutoff distance 2.0 1cv5 title: T4 lysozyme mutant L133M [more info...] Chain information for 1cv5 #152 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1cv5 #152 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 48 non-polymer residues more than 3.0 Angstroms away. Alignment of 1cv5 chain A to query has RMSD 1.01 using 47 of 125 paired residues within cutoff distance 2.0 3cdt title: Contributions of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme [more info...] Chain information for 3cdt #153 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3cdt #153 --- BME — β-mercaptoethanol CL — chloride ion 40 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues more than 3.0 Angstroms away. Alignment of 3cdt chain A to query has RMSD 1 using 49 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 3cdo from http://files.rcsb.org/download/3cdo.cif Fetching CCD MPD from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/D/MPD/MPD.cif 3cdo title: Bacteriophage T4 lysozyme mutant R96V in wildtype background at low temperature [more info...] Chain information for 3cdo #154 --- Chain | Description | UniProt A B C D | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3cdo #154 --- HEZ — hexane-1,6-diol MPD — (4S)-2-methyl-2,4-pentanediol SO4 — sulfate ion 3cdo mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 3| author_defined_assembly 4| author_defined_assembly 165 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 3 extra chains, 9 C-terminal residues, 2 N-terminal residues, 674 non- polymer residues more than 3.0 Angstroms away. Alignment of 3cdo chain A to query has RMSD 1.31 using 59 of 124 paired residues within cutoff distance 2.0 255l title: Hydrolase [more info...] Chain information for 255l #155 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 255l #155 --- BME — β-mercaptoethanol CL — chloride ion Deleted 11 C-terminal residues, 2 N-terminal residues, 80 non-polymer residues more than 3.0 Angstroms away. Alignment of 255l chain A to query has RMSD 1.01 using 49 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1t8f from http://files.rcsb.org/download/1t8f.cif 1t8f title: Crystal structure of phage T4 lysozyme mutant R14A/K16A/I17A/K19A/T21A/E22A/C54T/C97A [more info...] Chain information for 1t8f #156 --- Chain | Description | UniProt A | Lysozyme | LYCV_BPT4 1-164 Non-standard residues in 1t8f #156 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 37 non-polymer residues more than 3.0 Angstroms away. Alignment of 1t8f chain A to query has RMSD 0.892 using 46 of 127 paired residues within cutoff distance 2.0 1llh title: Are carboxy terminii of helices coded by the local sequence or by tertiary structure contacts [more info...] Chain information for 1llh #157 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 1llh #157 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 17 non-polymer residues more than 3.0 Angstroms away. Alignment of 1llh chain A to query has RMSD 0.985 using 48 of 126 paired residues within cutoff distance 2.0 1l38 title: Contributions of engineered surface salt bridges to the stability of T4 lysozyme determined by directed mutagenesis [more info...] Chain information for 1l38 #158 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l38 chain A to query has RMSD 1.03 using 49 of 125 paired residues within cutoff distance 2.0 1dyd title: Determination of α-helix propensity within the context of A folded protein: sites 44 and 131 In bacteriophage T4 lysozyme [more info...] Chain information for 1dyd #159 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1dyd #159 --- BME — β-mercaptoethanol CL — chloride ion Deleted 7 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues more than 3.0 Angstroms away. Alignment of 1dyd chain A to query has RMSD 0.963 using 46 of 127 paired residues within cutoff distance 2.0 161l title: Control of enzyme activity by an engineered disulfide bond [more info...] Chain information for 161l #160 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 161l #160 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues more than 3.0 Angstroms away. Alignment of 161l chain A to query has RMSD 1.03 using 50 of 126 paired residues within cutoff distance 2.0 131l title: Structures of randomly generated mutants of T4 lysozyme show that protein stability can Be enhanced by relaxation of strain and by improved hydrogen bonding via bound solvent [more info...] Chain information for 131l #161 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 131l #161 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 79 non-polymer residues more than 3.0 Angstroms away. Alignment of 131l chain A to query has RMSD 0.912 using 46 of 125 paired residues within cutoff distance 2.0 8jwy title: Crystal structure of A2AR-T4L in complex with 2-118 [more info...] Chain information for 8jwy #162 --- Chain | Description | UniProt A | Adenosine receptor A2a,Endolysin | AA2AR_HUMAN 2-208 369-463, D9IEF7_BPT4 209-368 Non-standard residues in 8jwy #162 --- CLR — cholesterol NA — sodium ion OLA — oleic acid OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) VBF — 3-[2-azanyl-6-[2-oxidanylidene-1-[[6-(2-oxidanylpropan-2-yl)pyridin-2-yl]methyl]pyridin-4-yl]pyrimidin-4-yl]-2-methyl- benzenecarbonitrile Deleted 97 C-terminal residues, 200 N-terminal residues, 212 non-polymer residues more than 3.0 Angstroms away. Alignment of 8jwy chain A to query has RMSD 1.08 using 58 of 126 paired residues within cutoff distance 2.0 7loc title: T4 lysozyme mutant L99A in complex with 1-bromanyl-4-fluoranyl-benzene [more info...] Chain information for 7loc #163 --- Chain | Description | UniProt A | Lysozyme | D9IEF7_BPT4 1-164 Non-standard residues in 7loc #163 --- BME — β-mercaptoethanol TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer) Y87 — 1-bromanyl-4-fluoranyl-benzene 44 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 10 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues more than 3.0 Angstroms away. Alignment of 7loc chain A to query has RMSD 0.947 using 45 of 125 paired residues within cutoff distance 2.0 6zg4 title: Structure of M1-StaR-T4L in complex with HTL0009936 at 2.35A [more info...] Chain information for 6zg4 #164 --- Chain | Description | UniProt A | Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1 | ACM1_HUMAN 27-219 354-438, ENLYS_BPT4 1002-1161 Non-standard residues in 6zg4 #164 --- OLA — oleic acid PGE — triethylene glycol PO4 — phosphate ion QK8 — ethyl (4~{S})-4-[4-[(1-methylcyclobutyl)carbamoyl]piperidin-1-yl]azepane-1-carboxylate 3556 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 93 C-terminal residues, 200 N-terminal residues, 68 non-polymer residues more than 3.0 Angstroms away. Alignment of 6zg4 chain A to query has RMSD 1.04 using 56 of 129 paired residues within cutoff distance 2.0 5jwu title: T4 Lysozyme L99A/M102Q with 1,2-Dihydro-1,2-azaborine Bound [more info...] Chain information for 5jwu #165 --- Chain | Description | UniProt A | Endolysin | ENLYS_BPT4 1-164 Non-standard residues in 5jwu #165 --- B20 — 1,2-dihydro-1,2-azaborinine (1,2-dihydro-1,2-azaborine) CL — chloride ion 96 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 8 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues more than 3.0 Angstroms away. Alignment of 5jwu chain A to query has RMSD 0.952 using 44 of 127 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 4pjz from http://files.rcsb.org/download/4pjz.cif Fetching CCD 3FG from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/G/3FG/3FG.cif Fetching CCD 3MY from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/Y/3MY/3MY.cif Fetching CCD AIB from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/B/AIB/AIB.cif Fetching CCD DAL from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/L/DAL/DAL.cif Fetching CCD GCS from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/S/GCS/GCS.cif Fetching CCD GHP from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/GHP/GHP.cif Fetching CCD MAN from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/N/MAN/MAN.cif Fetching CCD OMY from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/Y/OMY/OMY.cif Fetching CCD T55 from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/5/T55/T55.cif 4pjz title: Crystal structure of T4 lysozyme-GSS-peptide In complex with teicoplanin-A2-2 [more info...] Chain information for 4pjz #166 --- Chain | Description | UniProt A | Lysozyme | D9IEF7_BPT4 1-164 B | TEICOPLANIN-A2-2 | Non-standard residues in 4pjz #166 --- 3FG — (2S)-amino(3,5-dihydroxyphenyl)ethanoic acid GCS — 2-amino-2-deoxy-beta-D-glucopyranose (beta-D-glucosamine; 2-amino-2-deoxy-beta-D-glucose; 2-amino-2-deoxy-D-glucose; 2-amino-2-deoxy- glucose; D-GLUCOSAMINE) GOL — glycerol (glycerin; propane-1,2,3-triol) MAN — alpha-D-mannopyranose (alpha-D-mannose; D-mannose; mannose) NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE) PO4 — phosphate ion T55 — 8-methylnonanoic acid 15 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 1 extra chains, 13 C-terminal residues, 2 N-terminal residues, 51 non- polymer residues more than 3.0 Angstroms away. Alignment of 4pjz chain A to query has RMSD 0.889 using 45 of 124 paired residues within cutoff distance 2.0 4exm title: The crystal structure of an engineered phage lysin containing the binding domain of pesticin and the killing domain of T4-lysozyme [more info...] Chain information for 4exm #167 --- Chain | Description | UniProt A B C D | Pesticin, Lysozyme Chimera | Q57159_YERPE 6-172, LYS_BPT4 173-334 4exm mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 9712 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 3 extra chains, 10 C-terminal residues, 167 N-terminal residues, 70 non-polymer residues more than 3.0 Angstroms away. Alignment of 4exm chain C to query has RMSD 1.11 using 52 of 127 paired residues within cutoff distance 2.0 227l title: Generating ligand binding sites In T4 lysozyme using deficiency-creating substitutions [more info...] Chain information for 227l #168 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 227l #168 --- BME — β-mercaptoethanol BNZ — benzene CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues more than 3.0 Angstroms away. Alignment of 227l chain A to query has RMSD 1.03 using 49 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l89 from http://files.rcsb.org/download/1l89.cif 1l89 title: Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4 lysozyme have different structural and thermodynamic consequences [more info...] Chain information for 1l89 #169 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l89 #169 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l89 chain A to query has RMSD 1.07 using 51 of 125 paired residues within cutoff distance 2.0 1dyf title: Determination of α-helix propensity within the context of A folded protein: sites 44 and 131 In bacteriophage T4 lysozyme [more info...] Chain information for 1dyf #170 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1dyf #170 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues more than 3.0 Angstroms away. Alignment of 1dyf chain A to query has RMSD 0.976 using 47 of 127 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 166l from http://files.rcsb.org/download/166l.cif 166l title: Control of enzyme activity by an engineered disulfide bond [more info...] Chain information for 166l #171 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 166l #171 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues more than 3.0 Angstroms away. Alignment of 166l chain A to query has RMSD 1.03 using 49 of 125 paired residues within cutoff distance 2.0 4w58 title: T4 Lysozyme L99A with n-Pentylbenzene Bound [more info...] Chain information for 4w58 #172 --- Chain | Description | UniProt A | Endolysin | ENLYS_BPT4 1-164 Non-standard residues in 4w58 #172 --- 3H2 — pentylbenzene EPE — 4-(2-hydroxyethyl)-1-piperazine ethanesulfonic acid (HEPES) 161 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 12 C-terminal residues, 2 N-terminal residues, 39 non-polymer residues more than 3.0 Angstroms away. Alignment of 4w58 chain A to query has RMSD 0.996 using 46 of 124 paired residues within cutoff distance 2.0 3c7z title: T4 lysozyme mutant D89A/R96H at room temperature [more info...] Chain information for 3c7z #173 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3c7z #173 --- BME — β-mercaptoethanol CL — chloride ion 29 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 26 non-polymer residues more than 3.0 Angstroms away. Alignment of 3c7z chain A to query has RMSD 0.984 using 48 of 127 paired residues within cutoff distance 2.0 1qt7 title: E11N Mutant of T4 Lysozyme [more info...] Chain information for 1qt7 #174 --- Chain | Description | UniProt A | PROTEIN (T4 LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1qt7 #174 --- BME — β-mercaptoethanol CL — chloride ion Deleted 11 C-terminal residues, 2 N-terminal residues, 86 non-polymer residues more than 3.0 Angstroms away. Alignment of 1qt7 chain A to query has RMSD 1 using 48 of 125 paired residues within cutoff distance 2.0 196l title: Thermodynamic and structural compensation In ""size-switch"" core-repacking variants of T4 lysozyme [more info...] Chain information for 196l #175 --- Chain | Description | UniProt A | LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 196l #175 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues more than 3.0 Angstroms away. Alignment of 196l chain A to query has RMSD 1.03 using 49 of 124 paired residues within cutoff distance 2.0 189l title: Enhancement of protein stability by the combination of point mutations In T4 lysozyme is additive [more info...] Chain information for 189l #176 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 24 non-polymer residues more than 3.0 Angstroms away. Alignment of 189l chain A to query has RMSD 1.26 using 57 of 127 paired residues within cutoff distance 2.0 7z36 title: Crystal structure of the KAP1 tripartite motif in complex with the ZNF93 KRAB domain [more info...] Chain information for 7z36 #177 --- Chain | Description | UniProt A B | Endolysin,Transcription intermediary factor 1-beta,Isoform 2 of Transcription intermediary factor 1-beta | ENLYS_BPT4 26-185, TIF1B_HUMAN 187-271, TIF1B-2_HUMAN 272-482 C S | SMARCAD1 CUE1 domain | D | Zinc finger protein 93 | ZNF93_HUMAN 2-71 Non-standard residues in 7z36 #177 --- ZN — zinc ion 7889 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 4 extra chains, 284 C-terminal residues, 1 N-terminal residues, 8 non- polymer residues more than 3.0 Angstroms away. Alignment of 7z36 chain B to query has RMSD 1.13 using 54 of 135 paired residues within cutoff distance 2.0 7lx9 title: T4 lysozyme mutant L99A [more info...] Chain information for 7lx9 #178 --- Chain | Description | UniProt A | Lysozyme | D9IEF7_BPT4 1-164 Non-standard residues in 7lx9 #178 --- TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer) YGM — (but-3-en-1-yl)benzene 5 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 9 C-terminal residues, 2 N-terminal residues, 31 non-polymer residues more than 3.0 Angstroms away. Alignment of 7lx9 chain A to query has RMSD 0.917 using 44 of 123 paired residues within cutoff distance 2.0 5lwo title: Structure of Spin-labelled T4 lysozyme mutant L115C-R119C-R1 at 100K [more info...] Chain information for 5lwo #179 --- Chain | Description | UniProt A | Endolysin | ENLYS_BPT4 1-164 Non-standard residues in 5lwo #179 --- BME — β-mercaptoethanol CL — chloride ion HED — 2-hydroxyethyl disulfide K — potassium ion PO4 — phosphate ion RXR — [2,2,5,5-tetramethyl-3,4-bis(sulfanylmethyl)-2,5-dihydro-1H-pyrrol-1-yl]oxidanyl radical (3,4-bis(thiomethyl)-2,2,5,5-tetramethyl-1H-Pyrrol-1-yloxyl radical) 511 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 1340 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 11 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues more than 3.0 Angstroms away. Alignment of 5lwo chain A to query has RMSD 0.973 using 49 of 124 paired residues within cutoff distance 2.0 4phu title: Crystal structure of Human GPR40 bound to allosteric agonist TAK-875 [more info...] Chain information for 4phu #180 --- Chain | Description | UniProt A | Free fatty acid receptor 1,Lysozyme | FFAR1_HUMAN 1-211 2214-2300, LYS_BPT4 1002-1161 Non-standard residues in 4phu #180 --- 1PE — pentaethylene glycol (PEG400) 2YB — [(3S)-6-({2',6'-dimethyl-4'-[3-(methylsulfonyl)propoxy]biphenyl-3-yl}methoxy)-2,3-dihydro-1-benzofuran-3-yl]acetic acid DMS — dimethyl sulfoxide OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) 14 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 3264 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 77 C-terminal residues, 206 N-terminal residues, 77 non-polymer residues more than 3.0 Angstroms away. Alignment of 4phu chain A to query has RMSD 0.953 using 47 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 3qak from http://files.rcsb.org/download/3qak.cif 3qak title: Agonist bound structure of the human adenosine A2a receptor [more info...] Chain information for 3qak #181 --- Chain | Description | UniProt A | Adenosine receptor A2a,lysozyme chimera | AA2AR_HUMAN 2-208 222-316, LYS_BPT4 1002-1161 Non-standard residues in 3qak #181 --- OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) UKA — 6-(2,2-diphenylethylamino)-9-[(2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxy- oxolan-2-yl]-N-[2-[(1-pyridin-2-ylpiperidin-4-yl)carbamoylamino]ethyl]purine-2-carboxamide 3480 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 95 C-terminal residues, 198 N-terminal residues, 7 non-polymer residues more than 3.0 Angstroms away. Alignment of 3qak chain A to query has RMSD 1.17 using 62 of 125 paired residues within cutoff distance 2.0 3cdq title: Contributions of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme [more info...] Chain information for 3cdq #182 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3cdq #182 --- BME — β-mercaptoethanol CL — chloride ion K — potassium ion 41 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 32 non-polymer residues more than 3.0 Angstroms away. Alignment of 3cdq chain A to query has RMSD 0.991 using 48 of 125 paired residues within cutoff distance 2.0 1pqj title: T4 lysozyme core repacking mutant A111V/CORE10/Ta [more info...] Chain information for 1pqj #183 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 1pqj #183 --- CL — chloride ion HED — 2-hydroxyethyl disulfide K — potassium ion 24 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues more than 3.0 Angstroms away. Alignment of 1pqj chain A to query has RMSD 0.926 using 44 of 124 paired residues within cutoff distance 2.0 1lpy title: Multiple Methionine Substitutions in T4 Lysozyme [more info...] Chain information for 1lpy #184 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1lpy #184 --- BME — β-mercaptoethanol CL — chloride ion PO4 — phosphate ion 12 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 9 C-terminal residues, 2 N-terminal residues, 45 non-polymer residues more than 3.0 Angstroms away. Alignment of 1lpy chain A to query has RMSD 1.11 using 50 of 126 paired residues within cutoff distance 2.0 1l70 title: Multiple stabilizing alanine replacements within α-helix 126-134 of T4 lysozyme have independent, additive effects on both structure and stability [more info...] Chain information for 1l70 #185 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l70 #185 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l70 chain A to query has RMSD 0.942 using 45 of 125 paired residues within cutoff distance 2.0 1l52 title: Structural and thermodynamic analysis of the packing of two α-helices In bacteriophage T4 lysozyme [more info...] Chain information for 1l52 #186 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l52 chain A to query has RMSD 0.99 using 47 of 125 paired residues within cutoff distance 2.0 1l43 title: Cumulative site-directed charge-change replacements In bacteriophage T4 lysozyme suggest that long-range electrostatic interactions contribute little to protein stability [more info...] Chain information for 1l43 #187 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l43 chain A to query has RMSD 0.999 using 48 of 126 paired residues within cutoff distance 2.0 1l22 title: Contributions of left-handed helical residues to the structure and stability of bacteriophage T4 lysozyme [more info...] Chain information for 1l22 #188 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l22 chain A to query has RMSD 1.02 using 48 of 125 paired residues within cutoff distance 2.0 1l05 title: Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of phage T4 lysozyme [more info...] Chain information for 1l05 #189 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l05 chain A to query has RMSD 0.996 using 48 of 125 paired residues within cutoff distance 2.0 1cu2 title: T4 lysozyme mutant L84M [more info...] Chain information for 1cu2 #190 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1cu2 #190 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues more than 3.0 Angstroms away. Alignment of 1cu2 chain A to query has RMSD 0.911 using 46 of 125 paired residues within cutoff distance 2.0 6iih title: crystal structure of mitochondrial calcium uptake 2(MICU2) [more info...] Chain information for 6iih #191 --- Chain | Description | UniProt A B | Endolysin,Calcium uptake protein 2, mitochondrial | ENLYS_BPT4 1-161, MICU2_HUMAN 164-485 Non-standard residues in 6iih #191 --- CA — calcium ion Deleted 1 extra chains, 284 C-terminal residues, 2 N-terminal residues, 764 non-polymer residues more than 3.0 Angstroms away. Alignment of 6iih chain B to query has RMSD 0.929 using 46 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 5cgc from http://files.rcsb.org/download/5cgc.cif Fetching CCD 51D from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/D/51D/51D.cif Fetching CCD MES from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/S/MES/MES.cif 5cgc title: Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane domain in complex with the negative allosteric modulator 3-chloro-4-fluoro-5-[6-(1H-pyrazol-1-yl)pyrimidin-4-yl]benzonitrile [more info...] Chain information for 5cgc #192 --- Chain | Description | UniProt A | Metabotropic glutamate receptor 5,Endolysin,Metabotropic glutamate receptor 5 | GRM5_HUMAN 569-678 679-836, ENLYS_BPT4 1002-1161 Non-standard residues in 5cgc #192 --- 51D — 3-chloro-4-fluoro-5-[6-(1H-pyrazol-1-yl)pyrimidin-4-yl]benzonitrile MES — 2-(N-morpholino)-ethanesulfonic acid OLA — oleic acid Deleted 146 C-terminal residues, 112 N-terminal residues, 44 non-polymer residues more than 3.0 Angstroms away. Alignment of 5cgc chain A to query has RMSD 1.15 using 66 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 4tn3 from http://files.rcsb.org/download/4tn3.cif 4tn3 title: Structure of the BBox-Coiled-coil region of Rhesus Trim5alpha [more info...] Chain information for 4tn3 #193 --- Chain | Description | UniProt A B | TRIM5/cyclophilin A fusion protein/T4 Lysozyme chimera | G9MAP5_MACMU 88-303, ENLYS_BPT4 304-467 Non-standard residues in 4tn3 #193 --- ZN — zinc ion Deleted 1 extra chains, 11 C-terminal residues, 159 N-terminal residues, 4 non-polymer residues more than 3.0 Angstroms away. Alignment of 4tn3 chain A to query has RMSD 1.03 using 48 of 160 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 3rze from http://files.rcsb.org/download/3rze.cif Fetching CCD 5EH from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/H/5EH/5EH.cif Fetching CCD D7V from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/V/D7V/D7V.cif 3rze title: Structure of the human histamine H1 receptor in complex with doxepin [more info...] Chain information for 3rze #194 --- Chain | Description | UniProt A | Histamine H1 receptor, Lysozyme chimera | HRH1_HUMAN 20-221 405-487, LYS_BPT4 1002-1161 Non-standard residues in 3rze #194 --- 5EH — (3E)-3-(dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-dimethylpropan-1-amine D7V — (3Z)-3-(dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-dimethylpropan-1-amine OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) PO4 — phosphate ion 42 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 3481 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 89 C-terminal residues, 188 N-terminal residues, 4 non-polymer residues more than 3.0 Angstroms away. Alignment of 3rze chain A to query has RMSD 1.09 using 56 of 126 paired residues within cutoff distance 2.0 3lzm title: Structural studies of mutants of T4 lysozyme that alter hydrophobic stabilization [more info...] Chain information for 3lzm #195 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues more than 3.0 Angstroms away. Alignment of 3lzm chain A to query has RMSD 1.05 using 50 of 125 paired residues within cutoff distance 2.0 3c7w title: Contributions of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme [more info...] Chain information for 3c7w #196 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3c7w #196 --- BME — β-mercaptoethanol CL — chloride ion 25 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 36 non-polymer residues more than 3.0 Angstroms away. Alignment of 3c7w chain A to query has RMSD 0.989 using 48 of 124 paired residues within cutoff distance 2.0 1p3n title: Core redesign back-revertant I103V/CORE10 [more info...] Chain information for 1p3n #197 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1p3n #197 --- CL — chloride ion HED — 2-hydroxyethyl disulfide K — potassium ion PO4 — phosphate ion 16 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 99 non-polymer residues more than 3.0 Angstroms away. Alignment of 1p3n chain A to query has RMSD 0.991 using 48 of 127 paired residues within cutoff distance 2.0 1l83 title: A cavity-containing mutant of T4 lysozyme is stabilized by buried benzene [more info...] Chain information for 1l83 #198 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l83 #198 --- BME — β-mercaptoethanol BNZ — benzene CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l83 chain A to query has RMSD 0.952 using 47 of 127 paired residues within cutoff distance 2.0 1l47 title: Cumulative site-directed charge-change replacements In bacteriophage T4 lysozyme suggest that long-range electrostatic interactions contribute little to protein stability [more info...] Chain information for 1l47 #199 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 10 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l47 chain A to query has RMSD 1 using 49 of 126 paired residues within cutoff distance 2.0 1l17 title: Hydrophobic stabilization In T4 lysozyme determined directly by multiple substitutions of ile 3 [more info...] Chain information for 1l17 #200 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l17 chain A to query has RMSD 0.985 using 48 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l16 from http://files.rcsb.org/download/1l16.cif 1l16 title: Structural analysis of the temperature-sensitive mutant of bacteriophage T4 lysozyme, glycine 156 (right arrow) aspartic acid [more info...] Chain information for 1l16 #201 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l16 chain A to query has RMSD 1.04 using 50 of 125 paired residues within cutoff distance 2.0 1l13 title: Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of phage T4 lysozyme [more info...] Chain information for 1l13 #202 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 54 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l13 chain A to query has RMSD 1.03 using 49 of 125 paired residues within cutoff distance 2.0 1l11 title: Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of phage T4 lysozyme [more info...] Chain information for 1l11 #203 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l11 #203 --- BME — β-mercaptoethanol Deleted 11 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l11 chain A to query has RMSD 1.02 using 48 of 125 paired residues within cutoff distance 2.0 1l06 title: Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of phage T4 lysozyme [more info...] Chain information for 1l06 #204 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l06 chain A to query has RMSD 1.03 using 49 of 124 paired residues within cutoff distance 2.0 1ky0 title: Methionine core mutant of T4 lysozyme [more info...] Chain information for 1ky0 #205 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-162 Non-standard residues in 1ky0 #205 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues more than 3.0 Angstroms away. Alignment of 1ky0 chain A to query has RMSD 1.01 using 51 of 126 paired residues within cutoff distance 2.0 1c6a title: T4 lysozyme mutant C54T/C97A/L133A In the presence of 8 atm krypton [more info...] Chain information for 1c6a #206 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1c6a #206 --- BME — β-mercaptoethanol CL — chloride ion KR — krypton Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues more than 3.0 Angstroms away. Alignment of 1c6a chain A to query has RMSD 1.05 using 49 of 125 paired residues within cutoff distance 2.0 158l title: Control of enzyme activity by an engineered disulfide bond [more info...] Chain information for 158l #207 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 158l #207 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues more than 3.0 Angstroms away. Alignment of 158l chain A to query has RMSD 1.03 using 49 of 125 paired residues within cutoff distance 2.0 126l title: The energetic cost and the structural consequences of burying A hydroxyl group within the core of A protein determined from ala to ser and val to THR substitutions In T4 lysozyme [more info...] Chain information for 126l #208 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 126l #208 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues more than 3.0 Angstroms away. Alignment of 126l chain A to query has RMSD 1.03 using 49 of 125 paired residues within cutoff distance 2.0 120l title: The energetic cost and the structural consequences of burying A hydroxyl group within the core of A protein determined from ala to ser and val to THR substitutions In T4 lysozyme [more info...] Chain information for 120l #209 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 120l #209 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 84 non-polymer residues more than 3.0 Angstroms away. Alignment of 120l chain A to query has RMSD 1.03 using 50 of 125 paired residues within cutoff distance 2.0 118l title: The energetic cost and the structural consequences of burying A hydroxyl group within the core of A protein determined from ala to ser and val to THR substitutions In T4 lysozyme [more info...] Chain information for 118l #210 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 118l #210 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues more than 3.0 Angstroms away. Alignment of 118l chain A to query has RMSD 0.996 using 48 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 8jwz from http://files.rcsb.org/download/8jwz.cif Fetching CCD U30 from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/0/U30/U30.cif 8jwz title: Crystal structure of A2AR-T4L in complex with AB928 [more info...] Chain information for 8jwz #211 --- Chain | Description | UniProt A | Adenosine receptor A2a,Endolysin | AA2AR_HUMAN 2-208 369-463, D9IEF7_BPT4 209-368 Non-standard residues in 8jwz #211 --- CLR — cholesterol NA — sodium ion OLA — oleic acid OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) PEG — di(hydroxyethyl)ether U30 — 3-[2-azanyl-6-[1-[[6-(2-oxidanylpropan-2-yl)pyridin-2-yl]methyl]-1,2,3-triazol-4-yl]pyrimidin-4-yl]-2-methyl- benzenecarbonitrile Deleted 97 C-terminal residues, 202 N-terminal residues, 254 non-polymer residues more than 3.0 Angstroms away. Alignment of 8jwz chain A to query has RMSD 1.09 using 58 of 126 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 5dgy from http://files.rcsb.org/download/5dgy.cif 5dgy title: Crystal structure of rhodopsin bound to visual arrestin [more info...] Chain information for 5dgy #212 --- Chain | Description | UniProt A B C D | Endolysin,Rhodopsin,S-arrestin | ENLYS_BPT4 -159-0, OPSD_HUMAN 1-994, ARRS_MOUSE 1010-1392 5dgy mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 24665 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 3 extra chains, 681 C-terminal residues, 1 N-terminal residues. Alignment of 5dgy chain A to query has RMSD 1.23 using 61 of 125 paired residues within cutoff distance 2.0 3hwl title: Crystal Structure of T4 lysozyme with the unnatural amino acid p-Acetyl-L- Phenylalanine incorporated at position 131 [more info...] Chain information for 3hwl #213 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3hwl #213 --- AZI — azide ion CL — chloride ion 3hwl mmCIF Assemblies --- 1| software_defined_assembly 6 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 1431 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Hit structure sequence 3hwl_A amino acid F at sequence position 130 does not match sequence alignment N at position 128. Structure sequence MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAFNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL. Alignment sequence IFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAANLAKSRWYNQTPNRAKRVITTF. Deleted 10 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues more than 3.0 Angstroms away. Alignment of 3hwl chain A to query has RMSD 0.82 using 37 of 125 paired residues within cutoff distance 2.0 239l title: The response of T4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect [more info...] Chain information for 239l #214 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 239l #214 --- CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues more than 3.0 Angstroms away. Alignment of 239l chain A to query has RMSD 0.956 using 47 of 126 paired residues within cutoff distance 2.0 229l title: Generating ligand binding sites In T4 lysozyme using deficiency-creating substitutions [more info...] Chain information for 229l #215 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 229l #215 --- BME — β-mercaptoethanol CL — chloride ion GAI — guanidine Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues more than 3.0 Angstroms away. Alignment of 229l chain A to query has RMSD 1.03 using 51 of 125 paired residues within cutoff distance 2.0 211l title: Protein structure plasticity exemplified by insertion and deletion mutants In T4 lysozyme [more info...] Chain information for 211l #216 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 211l #216 --- HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues more than 3.0 Angstroms away. Alignment of 211l chain A to query has RMSD 0.989 using 47 of 125 paired residues within cutoff distance 2.0 1qtb title: The introduction of strain and its effects on the structure and stability of T4 lysozyme [more info...] Chain information for 1qtb #217 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-162 Non-standard residues in 1qtb #217 --- HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues more than 3.0 Angstroms away. Alignment of 1qtb chain A to query has RMSD 1.02 using 49 of 126 paired residues within cutoff distance 2.0 1pqo title: T4 Lysozyme Core Repacking Mutant L118I/TA [more info...] Chain information for 1pqo #218 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 1pqo #218 --- CL — chloride ion HED — 2-hydroxyethyl disulfide K — potassium ion 10 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues more than 3.0 Angstroms away. Alignment of 1pqo chain A to query has RMSD 0.949 using 48 of 127 paired residues within cutoff distance 2.0 1l44 title: Cumulative site-directed charge-change replacements In bacteriophage T4 lysozyme suggest that long-range electrostatic interactions contribute little to protein stability [more info...] Chain information for 1l44 #219 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l44 chain A to query has RMSD 0.943 using 46 of 125 paired residues within cutoff distance 2.0 1l28 title: Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter protein stability [more info...] Chain information for 1l28 #220 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l28 chain A to query has RMSD 1.06 using 50 of 127 paired residues within cutoff distance 2.0 1l02 title: Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of phage T4 lysozyme [more info...] Chain information for 1l02 #221 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l02 chain A to query has RMSD 1.04 using 50 of 127 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l00 from http://files.rcsb.org/download/1l00.cif 1l00 title: Perturbation of TRP 138 In T4 lysozyme by mutations At GLN 105 used to correlate changes In structure, stability, solvation, and spectroscopic properties [more info...] Chain information for 1l00 #222 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l00 #222 --- BME — β-mercaptoethanol Deleted 9 C-terminal residues, 2 N-terminal residues, 78 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l00 chain A to query has RMSD 0.995 using 46 of 127 paired residues within cutoff distance 2.0 1g07 title: Crystal structure of T4 lysozyme mutant V149C [more info...] Chain information for 1g07 #223 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1g07 #223 --- CL — chloride ion HED — 2-hydroxyethyl disulfide 1 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 9 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues more than 3.0 Angstroms away. Alignment of 1g07 chain A to query has RMSD 1.01 using 49 of 125 paired residues within cutoff distance 2.0 199l title: Thermodynamic and structural compensation In ""size-switch"" core-repacking variants of T4 lysozyme [more info...] Chain information for 199l #224 --- Chain | Description | UniProt A | LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 199l #224 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues more than 3.0 Angstroms away. Alignment of 199l chain A to query has RMSD 1.03 using 51 of 124 paired residues within cutoff distance 2.0 195l title: Thermodynamic and structural compensation In ""size-switch"" core-repacking variants of T4 lysozyme [more info...] Chain information for 195l #225 --- Chain | Description | UniProt A | LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 195l #225 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues more than 3.0 Angstroms away. Alignment of 195l chain A to query has RMSD 0.95 using 48 of 127 paired residues within cutoff distance 2.0 7p41 title: Crystal Structure of human mARC1 A165T Variant [more info...] Chain information for 7p41 #226 --- Chain | Description | UniProt D | Mitochondrial amidoxime-reducing component 1,Endolysin,Mitochondrial amidoxime-reducing component 1 | MARC1_HUMAN 53-128 288-495, D9IEF7_BPT4 129-287 Non-standard residues in 7p41 #226 --- B3P — 2-[3-(2-hydroxy-1,1-dihydroxymethyl- ethylamino)-propylamino]-2-hydroxymethyl-propane-1,3-diol CL — chloride ion EFK — oxidanyl(oxidanylidene)molybdenum MTE — phosphonic acidmono-(2-amino-5,6-dimercapto-4-oxo-3,7,8A,9,10,10A-hexahydro-4H-8-oxa-1,3,9,10-tetraaza- anthracen-7-ylmethyl)ester 63 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 214 C-terminal residues, 79 N-terminal residues, 402 non-polymer residues more than 3.0 Angstroms away. Alignment of 7p41 chain D to query has RMSD 0.947 using 48 of 125 paired residues within cutoff distance 2.0 7lxa title: T4 lysozyme mutant L99A [more info...] Chain information for 7lxa #227 --- Chain | Description | UniProt A | Lysozyme | D9IEF7_BPT4 1-164 Non-standard residues in 7lxa #227 --- BME — β-mercaptoethanol TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer) YGS — (2-methylprop-2-en-1-yl)benzene 9 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 9 C-terminal residues, 1 N-terminal residues, 34 non-polymer residues more than 3.0 Angstroms away. Alignment of 7lxa chain A to query has RMSD 0.922 using 44 of 122 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 6luq from http://files.rcsb.org/download/6luq.cif Fetching CCD GMJ from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/J/GMJ/GMJ.cif 6luq title: Haloperidol bound D2 dopamine receptor structure inspired discovery of subtype selective ligands [more info...] Chain information for 6luq #228 --- Chain | Description | UniProt A | chimera of D(2) dopamine receptor and Endolysin | DRD2_HUMAN 35-222 388-464, D9IEF7_BPT4 Non-standard residues in 6luq #228 --- GMJ — 4-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one OLA — oleic acid Deleted 85 C-terminal residues, 184 N-terminal residues, 12 non-polymer residues more than 3.0 Angstroms away. Alignment of 6luq chain A to query has RMSD 1.03 using 54 of 126 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 3sb5 from http://files.rcsb.org/download/3sb5.cif 3sb5 title: Zn-mediated Trimer of T4 Lysozyme R125C/E128C by Synthetic Symmetrization [more info...] Chain information for 3sb5 #229 --- Chain | Description | UniProt A B C D | Lysozyme | LYS_BPT4 1-162 Non-standard residues in 3sb5 #229 --- CL — chloride ion GOL — glycerol (glycerin; propane-1,2,3-triol) MG — magnesium ion ZN — zinc ion 3sb5 mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 3| author_and_software_defined_assembly 4| author_and_software_defined_assembly 8 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 5326 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 3 extra chains, 9 C-terminal residues, 4 N-terminal residues, 191 non- polymer residues more than 3.0 Angstroms away. Alignment of 3sb5 chain A to query has RMSD 1.17 using 68 of 125 paired residues within cutoff distance 2.0 3jr6 title: Sequential reorganization of beta-sheet topology by insertion of a single strand [more info...] Chain information for 3jr6 #230 --- Chain | Description | UniProt A B C D | Lysozyme | LYS_BPT4 1-170 Non-standard residues in 3jr6 #230 --- SO4 — sulfate ion 3jr6 mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 3| author_defined_assembly 4| author_defined_assembly Deleted 3 extra chains, 10 C-terminal residues, 2 N-terminal residues, 6 non- polymer residues more than 3.0 Angstroms away. Alignment of 3jr6 chain B to query has RMSD 1.16 using 60 of 123 paired residues within cutoff distance 2.0 3cdr title: R96Q Mutant of wildtype phage T4 lysozyme at 298 K [more info...] Chain information for 3cdr #231 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3cdr #231 --- CL — chloride ion HED — 2-hydroxyethyl disulfide 31 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 40 non-polymer residues more than 3.0 Angstroms away. Alignment of 3cdr chain A to query has RMSD 0.992 using 48 of 125 paired residues within cutoff distance 2.0 3c8q title: Contribution of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme [more info...] Chain information for 3c8q #232 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3c8q #232 --- BME — β-mercaptoethanol CL — chloride ion K — potassium ion 41 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 29 non-polymer residues more than 3.0 Angstroms away. Alignment of 3c8q chain A to query has RMSD 0.954 using 47 of 125 paired residues within cutoff distance 2.0 233l title: T4 lysozyme mutant M120L [more info...] Chain information for 233l #233 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 233l #233 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues more than 3.0 Angstroms away. Alignment of 233l chain A to query has RMSD 0.947 using 46 of 125 paired residues within cutoff distance 2.0 1ov7 title: T4 Lysozyme Cavity Mutant L99A/M102Q Bound with 2-Allyl-6-Methyl-Phenol [more info...] Chain information for 1ov7 #234 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 1ov7 #234 --- BME — β-mercaptoethanol CL — chloride ion LYL — 2-allyl-6-methyl-phenol Deleted 9 C-terminal residues, 2 N-terminal residues, 22 non-polymer residues more than 3.0 Angstroms away. Alignment of 1ov7 chain A to query has RMSD 0.956 using 46 of 125 paired residues within cutoff distance 2.0 1lyf title: Dissection of helix capping In T4 lysozyme by structural and thermodynamic analysis of six amino acid substitutions At THR 59 [more info...] Chain information for 1lyf #235 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1lyf #235 --- BME — β-mercaptoethanol CL — chloride ion Deleted 7 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues more than 3.0 Angstroms away. Alignment of 1lyf chain A to query has RMSD 0.934 using 46 of 127 paired residues within cutoff distance 2.0 1l81 title: Design and structural analysis of alternative hydrophobic core packing arrangements In bacteriophage T4 lysozyme [more info...] Chain information for 1l81 #236 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l81 #236 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l81 chain A to query has RMSD 1.12 using 53 of 124 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l54 from http://files.rcsb.org/download/1l54.cif 1l54 title: The structural and thermodynamic consequences of burying A charged residue within the hydrophobic core of T4 lysozyme [more info...] Chain information for 1l54 #237 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l54 chain A to query has RMSD 0.936 using 46 of 125 paired residues within cutoff distance 2.0 1l50 title: Structural and thermodynamic analysis of the packing of two α-helices In bacteriophage T4 lysozyme [more info...] Chain information for 1l50 #238 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l50 chain A to query has RMSD 1.03 using 48 of 127 paired residues within cutoff distance 2.0 1l23 title: Enhanced protein thermostability from site-directed mutations that decrease the entropy of unfolding [more info...] Chain information for 1l23 #239 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l23 chain A to query has RMSD 1.03 using 49 of 125 paired residues within cutoff distance 2.0 1l19 title: Enhanced protein thermostability from designed mutations that interact with α-helix dipoles [more info...] Chain information for 1l19 #240 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l19 chain A to query has RMSD 1.04 using 49 of 125 paired residues within cutoff distance 2.0 1jqu title: Are Carboxy Terminii of Helices Coded by the Local Sequence or by Tertiary Structure Contacts [more info...] Chain information for 1jqu #241 --- Chain | Description | UniProt A B C D | Lysozyme | LYS_BPT4 1-164 1jqu mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 3| author_defined_assembly 4| author_defined_assembly Deleted 3 extra chains, 11 C-terminal residues, 2 N-terminal residues, 28 non- polymer residues more than 3.0 Angstroms away. Alignment of 1jqu chain D to query has RMSD 1.24 using 52 of 121 paired residues within cutoff distance 2.0 1d2y title: N-terminal domain core methionine mutation [more info...] Chain information for 1d2y #242 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1d2y #242 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues more than 3.0 Angstroms away. Alignment of 1d2y chain A to query has RMSD 0.962 using 47 of 125 paired residues within cutoff distance 2.0 1cu6 title: T4 lysozyme mutant L91A [more info...] Chain information for 1cu6 #243 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1cu6 #243 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues more than 3.0 Angstroms away. Alignment of 1cu6 chain A to query has RMSD 0.97 using 47 of 127 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1b6i from http://files.rcsb.org/download/1b6i.cif 1b6i title: T4 lysozyme mutant with cys 54 replaced by THR, cys 97 replaced by ala, THR 21 replaced by cys and lys 124 replaced by cys (C54T,C97A,T21C,K124C) [more info...] Chain information for 1b6i #244 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1b6i #244 --- HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 33 non-polymer residues more than 3.0 Angstroms away. Alignment of 1b6i chain A to query has RMSD 0.986 using 47 of 125 paired residues within cutoff distance 2.0 138l title: Rapid crystallization of T4 lysozyme by intermolecular disulfide crosslinking [more info...] Chain information for 138l #245 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 138l #245 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 50 non-polymer residues more than 3.0 Angstroms away. Alignment of 138l chain A to query has RMSD 0.981 using 48 of 125 paired residues within cutoff distance 2.0 130l title: Structures of randomly generated mutants of T4 lysozyme show that protein stability can Be enhanced by relaxation of strain and by improved hydrogen bonding via bound solvent [more info...] Chain information for 130l #246 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 130l #246 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 87 non-polymer residues more than 3.0 Angstroms away. Alignment of 130l chain A to query has RMSD 0.931 using 46 of 125 paired residues within cutoff distance 2.0 Atom OE1 has no neighbors to form bonds with according to residue template for GLN /A:-3 Atom NE2 has no neighbors to form bonds with according to residue template for GLN /A:-3 6xom title: DCN1 bound to 8 [more info...] Chain information for 6xom #247 --- Chain | Description | UniProt A | Lysozyme, DCN1-like protein 1 chimera | D9IEF7_BPT4 1-164, DCNL1_HUMAN 1062-1259 Non-standard residues in 6xom #247 --- EDO — 1,2-ethanediol (ethylene glycol) H8V — (2R)-N-[(2S)-2-cyclohexyl-2-({N-propanoyl-3-[6-(propan-2-yl)-1,3-benzothiazol-2-yl]-L-alanyl}amino)ethyl]-2-methyl-4-(morpholin-4-yl)butanamide 14 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 2837 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 201 C-terminal residues, 4 N-terminal residues, 207 non-polymer residues more than 3.0 Angstroms away. Alignment of 6xom chain A to query has RMSD 0.983 using 52 of 126 paired residues within cutoff distance 2.0 5d5a title: In meso in situ serial X-ray crystallography structure of the Beta2-adrenergic receptor at 100 K [more info...] Chain information for 5d5a #248 --- Chain | Description | UniProt A | Beta-2 adrenergic receptor,Endolysin,Beta-2 adrenergic receptor | ADRB2_HUMAN 1-230 263-365, ENLYS_BPT4 1002-1161 Non-standard residues in 5d5a #248 --- 12P — dodecaethylene glycol (polyethylene glycol PEG400) ACM — acetamide BGC — beta-D-glucopyranose (beta-D-glucose; D-glucose; glucose) BU1 — 1,4-butanediol CAU — (2S)-1-(9H-Carbazol-4-yloxy)-3-(isopropylamino)propan-2-ol ((S)-Carazolol) CLR — cholesterol GLC — alpha-D-glucopyranose (alpha-D-glucose; D-glucose; glucose) PLM — palmitic acid SO4 — sulfate ion Deleted 88 C-terminal residues, 197 N-terminal residues, 35 non-polymer residues more than 3.0 Angstroms away. Alignment of 5d5a chain A to query has RMSD 1.04 using 49 of 132 paired residues within cutoff distance 2.0 4lzm title: Comparison of the crystal structure of bacteriophage T4 lysozyme At low, medium, and high ionic strengths [more info...] Chain information for 4lzm #249 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 4lzm #249 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues more than 3.0 Angstroms away. Alignment of 4lzm chain A to query has RMSD 1.02 using 49 of 125 paired residues within cutoff distance 2.0 3htb title: 2-propylphenol in complex with T4 lysozyme L99A/M102Q [more info...] Chain information for 3htb #250 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3htb #250 --- BME — β-mercaptoethanol JZ4 — 2-propylphenol PO4 — phosphate ion 64 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 10 C-terminal residues, 2 N-terminal residues, 97 non-polymer residues more than 3.0 Angstroms away. Alignment of 3htb chain A to query has RMSD 0.981 using 47 of 123 paired residues within cutoff distance 2.0 1quh title: L99G/E108V mutant of T4 lysozyme [more info...] Chain information for 1quh #251 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162 Non-standard residues in 1quh #251 --- CL — chloride ion HEZ — hexane-1,6-diol Deleted 9 C-terminal residues, 2 N-terminal residues, 46 non-polymer residues more than 3.0 Angstroms away. Alignment of 1quh chain A to query has RMSD 0.994 using 49 of 127 paired residues within cutoff distance 2.0 1qt5 title: D20E mutant structure of T4 lysozyme [more info...] Chain information for 1qt5 #252 --- Chain | Description | UniProt A | PROTEIN (T4 LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1qt5 #252 --- HED — 2-hydroxyethyl disulfide Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues more than 3.0 Angstroms away. Alignment of 1qt5 chain A to query has RMSD 1 using 48 of 125 paired residues within cutoff distance 2.0 1l64 title: Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A polyalanine α-helix containing ten consecutive alanines [more info...] Chain information for 1l64 #253 --- Chain | Description | UniProt A | LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l64 #253 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l64 chain A to query has RMSD 0.937 using 46 of 124 paired residues within cutoff distance 2.0 1l58 title: Analysis of the interaction between charged side chains and the α-helix dipole using designed thermostable mutants of phage T4 lysozyme [more info...] Chain information for 1l58 #254 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l58 #254 --- BME — β-mercaptoethanol Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l58 chain A to query has RMSD 0.963 using 47 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l34 from http://files.rcsb.org/download/1l34.cif 1l34 title: High-resolution structure of the temperature-sensitive mutant of phage lysozyme, arg 96 (right arrow) his [more info...] Chain information for 1l34 #255 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l34 chain A to query has RMSD 1.02 using 48 of 125 paired residues within cutoff distance 2.0 1kw7 title: Methionine core mutant of T4 lysozyme [more info...] Chain information for 1kw7 #256 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-162 Non-standard residues in 1kw7 #256 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues more than 3.0 Angstroms away. Alignment of 1kw7 chain A to query has RMSD 0.975 using 46 of 125 paired residues within cutoff distance 2.0 1cu5 title: T4 lysozyme mutant L91M [more info...] Chain information for 1cu5 #257 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1cu5 #257 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues more than 3.0 Angstroms away. Alignment of 1cu5 chain A to query has RMSD 0.988 using 48 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 6igl from http://files.rcsb.org/download/6igl.cif Fetching CCD SIN from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/N/SIN/SIN.cif 6igl title: Crystal Structure of human ETB receptor in complex with IRL1620 [more info...] Chain information for 6igl #258 --- Chain | Description | UniProt A | Endothelin receptor type B,Endolysin,Endothelin receptor type B | EDNRB_HUMAN 66-303 311-407, A0A097J809_BPT4 1000-1159 B | IRL1620 | Non-standard residues in 6igl #258 --- CIT — citric acid OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) SIN — succinic acid SO4 — sulfate ion 8 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 1 extra chains, 100 C-terminal residues, 215 N-terminal residues, 31 non-polymer residues more than 3.0 Angstroms away. Alignment of 6igl chain A to query has RMSD 1.03 using 54 of 126 paired residues within cutoff distance 2.0 6bg5 title: Structure of 1-(benzo[d][1,3]dioxol-5-ylmethyl)-1-(1-propylpiperidin-4-yl)-3-(3-(trifluoromethyl)phenyl)urea bound to DCN1 [more info...] Chain information for 6bg5 #259 --- Chain | Description | UniProt A | Endolysin, DCN1-like protein 1 chimera | ENLYS_BPT4 1-164, DCNL1_HUMAN 1062-1259 Non-standard residues in 6bg5 #259 --- DQD — N-[(2H-1,3-benzodioxol-5-yl)methyl]-N-(1-propylpiperidin-4-yl)-N'-[3-(trifluoromethyl)phenyl]urea 158 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 3553 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 200 C-terminal residues, 15 N-terminal residues, 480 non-polymer residues more than 3.0 Angstroms away. Alignment of 6bg5 chain A to query has RMSD 1.26 using 67 of 121 paired residues within cutoff distance 2.0 243l title: The response of T4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect [more info...] Chain information for 243l #260 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 243l #260 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues more than 3.0 Angstroms away. Alignment of 243l chain A to query has RMSD 0.981 using 47 of 125 paired residues within cutoff distance 2.0 226l title: Generating ligand binding sites In T4 lysozyme using deficiency-creating substitutions [more info...] Chain information for 226l #261 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 226l #261 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues more than 3.0 Angstroms away. Alignment of 226l chain A to query has RMSD 0.942 using 45 of 126 paired residues within cutoff distance 2.0 1qsq title: Cavity creating mutation [more info...] Chain information for 1qsq #262 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1qsq #262 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues more than 3.0 Angstroms away. Alignment of 1qsq chain A to query has RMSD 0.989 using 48 of 125 paired residues within cutoff distance 2.0 1p7s title: T4 lysozyme core repacking mutant V103I/Ta [more info...] Chain information for 1p7s #263 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 11 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 83 non-polymer residues more than 3.0 Angstroms away. Alignment of 1p7s chain A to query has RMSD 1.3 using 60 of 124 paired residues within cutoff distance 2.0 1l98 title: Perturbation of TRP 138 In T4 lysozyme by mutations At GLN 105 used to correlate changes In structure, stability, solvation, and spectroscopic properties [more info...] Chain information for 1l98 #264 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l98 #264 --- BME — β-mercaptoethanol Deleted 11 C-terminal residues, 2 N-terminal residues, 88 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l98 chain A to query has RMSD 0.955 using 46 of 127 paired residues within cutoff distance 2.0 1l80 title: Design and structural analysis of alternative hydrophobic core packing arrangements In bacteriophage T4 lysozyme [more info...] Chain information for 1l80 #265 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l80 #265 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l80 chain A to query has RMSD 0.926 using 45 of 125 paired residues within cutoff distance 2.0 1l41 title: Contributions of engineered surface salt bridges to the stability of T4 lysozyme determined by directed mutagenesis [more info...] Chain information for 1l41 #266 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l41 chain A to query has RMSD 0.965 using 47 of 125 paired residues within cutoff distance 2.0 1l30 title: Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter protein stability [more info...] Chain information for 1l30 #267 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l30 chain A to query has RMSD 1.02 using 48 of 125 paired residues within cutoff distance 2.0 1g1v title: T4 lysozyme mutant C54T/C97A/I58T [more info...] Chain information for 1g1v #268 --- Chain | Description | UniProt A | LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1g1v #268 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues more than 3.0 Angstroms away. Alignment of 1g1v chain A to query has RMSD 0.909 using 45 of 125 paired residues within cutoff distance 2.0 191l title: A helix initiation signal In T4 lysozyme identified by polyalanine mutagenesis [more info...] Chain information for 191l #269 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 191l #269 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues more than 3.0 Angstroms away. Alignment of 191l chain A to query has RMSD 1.05 using 49 of 127 paired residues within cutoff distance 2.0 190l title: A helix initiation signal In T4 lysozyme identified by polyalanine mutagenesis [more info...] Chain information for 190l #270 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 190l #270 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues more than 3.0 Angstroms away. Alignment of 190l chain A to query has RMSD 0.973 using 46 of 127 paired residues within cutoff distance 2.0 2huk title: Crystal structure of T4 Lysozyme V131C synthetic dimer [more info...] Chain information for 2huk #271 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 2huk #271 --- SO4 — sulfate ion 2huk mmCIF Assemblies --- 1| author_defined_assembly 9 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 33 non-polymer residues more than 3.0 Angstroms away. Alignment of 2huk chain A to query has RMSD 1.04 using 54 of 127 paired residues within cutoff distance 2.0 236l title: The response of T4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect [more info...] Chain information for 236l #272 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 236l #272 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues more than 3.0 Angstroms away. Alignment of 236l chain A to query has RMSD 1.03 using 50 of 127 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1ovk from http://files.rcsb.org/download/1ovk.cif Fetching CCD NYL from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/L/NYL/NYL.cif 1ovk title: T4 Lysozyme Cavity Mutant L99A/M102Q Bound with N-Allyl-Aniline [more info...] Chain information for 1ovk #273 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 1ovk #273 --- BME — β-mercaptoethanol CL — chloride ion NYL — N-allyl-aniline Deleted 9 C-terminal residues, 2 N-terminal residues, 25 non-polymer residues more than 3.0 Angstroms away. Alignment of 1ovk chain A to query has RMSD 0.99 using 48 of 124 paired residues within cutoff distance 2.0 1c6t title: T4 lysozyme mutant C54T/C97A In the presence of 8 atm xenon [more info...] Chain information for 1c6t #274 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164 Non-standard residues in 1c6t #274 --- BME — β-mercaptoethanol CL — chloride ion XE — XENON Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues more than 3.0 Angstroms away. Alignment of 1c6t chain A to query has RMSD 0.981 using 49 of 125 paired residues within cutoff distance 2.0 160l title: Control of enzyme activity by an engineered disulfide bond [more info...] Chain information for 160l #275 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 160l #275 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues more than 3.0 Angstroms away. Alignment of 160l chain A to query has RMSD 0.997 using 48 of 125 paired residues within cutoff distance 2.0 139l title: Rapid crystallization of T4 lysozyme by intermolecular disulfide crosslinking [more info...] Chain information for 139l #276 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 139l #276 --- BME — β-mercaptoethanol CL — chloride ion 139l mmCIF Assemblies --- 1| author_defined_assembly 2| software_defined_assembly Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues more than 3.0 Angstroms away. Alignment of 139l chain A to query has RMSD 0.976 using 48 of 125 paired residues within cutoff distance 2.0 123l title: The energetic cost and the structural consequences of burying A hydroxyl group within the core of A protein determined from ala to ser and val to THR substitutions In T4 lysozyme [more info...] Chain information for 123l #277 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 123l #277 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues more than 3.0 Angstroms away. Alignment of 123l chain A to query has RMSD 0.999 using 48 of 125 paired residues within cutoff distance 2.0 5wf6 title: Agonist bound human A2a adenosine receptor with S91A mutation at 2.90 A resolution [more info...] Chain information for 5wf6 #278 --- Chain | Description | UniProt A | Human A2a adenosine receptor T4L chimera | AA2AR_HUMAN 2-208 222-316, ENLYS_BPT4 1002-1161 Non-standard residues in 5wf6 #278 --- OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) UKA — 6-(2,2-diphenylethylamino)-9-[(2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxy- oxolan-2-yl]-N-[2-[(1-pyridin-2-ylpiperidin-4-yl)carbamoylamino]ethyl]purine-2-carboxamide Deleted 94 C-terminal residues, 184 N-terminal residues, 4 non-polymer residues more than 3.0 Angstroms away. Alignment of 5wf6 chain A to query has RMSD 1.15 using 62 of 136 paired residues within cutoff distance 2.0 249l title: The response of T4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect [more info...] Chain information for 249l #279 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 249l #279 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues more than 3.0 Angstroms away. Alignment of 249l chain A to query has RMSD 0.968 using 47 of 125 paired residues within cutoff distance 2.0 235l title: The response of T4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect [more info...] Chain information for 235l #280 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 235l #280 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues more than 3.0 Angstroms away. Alignment of 235l chain A to query has RMSD 1.01 using 48 of 125 paired residues within cutoff distance 2.0 1ssy title: Crystal structure of phage T4 lysozyme mutant G28A/I29A/G30A/C54T/C97A [more info...] Chain information for 1ssy #281 --- Chain | Description | UniProt A B | Lysozyme | LYS_BPT4 1-164 1ssy mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 57 non- polymer residues more than 3.0 Angstroms away. Alignment of 1ssy chain B to query has RMSD 0.901 using 45 of 125 paired residues within cutoff distance 2.0 1nhb title: Specificity of ligand binding in a buried non-polar cavity of t4 lysozyme: linkage of dynamics and structural plasticity [more info...] Chain information for 1nhb #282 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1nhb #282 --- CL — chloride ion HED — 2-hydroxyethyl disulfide PYJ — phenylethane Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues more than 3.0 Angstroms away. Alignment of 1nhb chain A to query has RMSD 0.982 using 49 of 127 paired residues within cutoff distance 2.0 1l49 title: Structural and thermodynamic analysis of the packing of two α-helices In bacteriophage T4 lysozyme [more info...] Chain information for 1l49 #283 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l49 chain A to query has RMSD 1.1 using 49 of 125 paired residues within cutoff distance 2.0 1l33 title: Contributions of left-handed helical residues to the structure and stability of bacteriophage T4 lysozyme [more info...] Chain information for 1l33 #284 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l33 chain A to query has RMSD 1.03 using 49 of 125 paired residues within cutoff distance 2.0 1c64 title: T4 lysozyme mutant C54T/C97A/L121A In the presence of 8 atm krypton [more info...] Chain information for 1c64 #285 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164 Non-standard residues in 1c64 #285 --- BME — β-mercaptoethanol CL — chloride ion KR — krypton Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues more than 3.0 Angstroms away. Alignment of 1c64 chain A to query has RMSD 1.03 using 50 of 126 paired residues within cutoff distance 2.0 241l title: The response of T4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect [more info...] Chain information for 241l #286 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 241l #286 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues more than 3.0 Angstroms away. Alignment of 241l chain A to query has RMSD 0.932 using 46 of 125 paired residues within cutoff distance 2.0 1t97 title: Use of sequence duplication to engineer a ligand-triggered long-distance molecular switch in T4 Lysozyme [more info...] Chain information for 1t97 #287 --- Chain | Description | UniProt A B | Lysozyme | LYS_BPT4 1-175 1t97 mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 60 non- polymer residues more than 3.0 Angstroms away. Alignment of 1t97 chain A to query has RMSD 0.91 using 45 of 131 paired residues within cutoff distance 2.0 1cv4 title: T4 lysozyme mutant L118M [more info...] Chain information for 1cv4 #288 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1cv4 #288 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues more than 3.0 Angstroms away. Alignment of 1cv4 chain A to query has RMSD 1.02 using 48 of 125 paired residues within cutoff distance 2.0 159l title: Control of enzyme activity by an engineered disulfide bond [more info...] Chain information for 159l #289 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 159l #289 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues more than 3.0 Angstroms away. Alignment of 159l chain A to query has RMSD 0.945 using 47 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 6m9t from http://files.rcsb.org/download/6m9t.cif Fetching CCD J9P from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/J9P/J9P.cif 6m9t title: Crystal structure of EP3 receptor bound to misoprostol-FA [more info...] Chain information for 6m9t #290 --- Chain | Description | UniProt A | Prostaglandin E2 receptor EP3 subtype, Endolysin chimera | PE2R3_HUMAN 2-259 273-353, ENLYS_BPT4 1002-1161 Non-standard residues in 6m9t #290 --- J9P — (11alpha,12alpha,13E,16S)-11,16-dihydroxy-16-methyl-9-oxoprost-13-en-1-oic acid OLA — oleic acid OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) SO4 — sulfate ion 22 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 3416 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 87 C-terminal residues, 204 N-terminal residues, 13 non-polymer residues more than 3.0 Angstroms away. Alignment of 6m9t chain A to query has RMSD 1.38 using 75 of 128 paired residues within cutoff distance 2.0 4e97 title: T4 Lysozyme L99A/M102H with 2-Mercaptoethanol Bound [more info...] Chain information for 4e97 #291 --- Chain | Description | UniProt A B | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 4e97 #291 --- ACT — acetate ion BME — β-mercaptoethanol HED — 2-hydroxyethyl disulfide SO4 — sulfate ion 4e97 mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 305 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 2848 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 11 C-terminal residues, 3 N-terminal residues, 288 non-polymer residues more than 3.0 Angstroms away. Alignment of 4e97 chain B to query has RMSD 1.14 using 45 of 139 paired residues within cutoff distance 2.0 253l title: Lysozyme [more info...] Chain information for 253l #292 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 253l #292 --- BME — β-mercaptoethanol CL — chloride ion Deleted 11 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues more than 3.0 Angstroms away. Alignment of 253l chain A to query has RMSD 0.936 using 46 of 125 paired residues within cutoff distance 2.0 234l title: T4 lysozyme mutant M106L [more info...] Chain information for 234l #293 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 234l #293 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues more than 3.0 Angstroms away. Alignment of 234l chain A to query has RMSD 1.01 using 49 of 125 paired residues within cutoff distance 2.0 1qug title: E108V mutant of T4 lysozyme [more info...] Chain information for 1qug #294 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162 Non-standard residues in 1qug #294 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 43 non-polymer residues more than 3.0 Angstroms away. Alignment of 1qug chain A to query has RMSD 0.945 using 47 of 127 paired residues within cutoff distance 2.0 1p64 title: T4 lysozyme core repacking mutant L133F/Ta [more info...] Chain information for 1p64 #295 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1p64 #295 --- CL — chloride ion HED — 2-hydroxyethyl disulfide K — potassium ion 13 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 84 non-polymer residues more than 3.0 Angstroms away. Alignment of 1p64 chain A to query has RMSD 1.02 using 48 of 125 paired residues within cutoff distance 2.0 1l56 title: Analysis of the interaction between charged side chains and the α-helix dipole using designed thermostable mutants of phage T4 lysozyme [more info...] Chain information for 1l56 #296 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l56 #296 --- BME — β-mercaptoethanol Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l56 chain A to query has RMSD 0.937 using 45 of 127 paired residues within cutoff distance 2.0 1g0q title: Crystal structure of T4 lysozyme mutant V149I [more info...] Chain information for 1g0q #297 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1g0q #297 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues more than 3.0 Angstroms away. Alignment of 1g0q chain A to query has RMSD 1.02 using 49 of 127 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1dye from http://files.rcsb.org/download/1dye.cif 1dye title: Determination of α-helix propensity within the context of A folded protein: sites 44 and 131 In bacteriophage T4 lysozyme [more info...] Chain information for 1dye #298 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1dye #298 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues more than 3.0 Angstroms away. Alignment of 1dye chain A to query has RMSD 1.05 using 49 of 127 paired residues within cutoff distance 2.0 156l title: Control of enzyme activity by an engineered disulfide bond [more info...] Chain information for 156l #299 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 156l #299 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 78 non-polymer residues more than 3.0 Angstroms away. Alignment of 156l chain A to query has RMSD 0.973 using 47 of 125 paired residues within cutoff distance 2.0 109l title: Structural basis of α-helix propensity At two sites In T4 lysozyme [more info...] Chain information for 109l #300 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 109l #300 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues more than 3.0 Angstroms away. Alignment of 109l chain A to query has RMSD 0.986 using 44 of 122 paired residues within cutoff distance 2.0 4i7j title: T4 Lysozyme L99A/M102H with benzene bound [more info...] Chain information for 4i7j #301 --- Chain | Description | UniProt A B | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 4i7j #301 --- ACT — acetate ion BME — β-mercaptoethanol BNZ — benzene HED — 2-hydroxyethyl disulfide SO4 — sulfate ion 4i7j mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 104 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 2809 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 11 C-terminal residues, 13 N-terminal residues, 178 non-polymer residues more than 3.0 Angstroms away. Alignment of 4i7j chain A to query has RMSD 1.2 using 47 of 126 paired residues within cutoff distance 2.0 257l title: AN adaptable metal-binding site engineered INTO T4 lysozyme [more info...] Chain information for 257l #302 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 257l #302 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues more than 3.0 Angstroms away. Alignment of 257l chain A to query has RMSD 1.03 using 49 of 125 paired residues within cutoff distance 2.0 248l title: The response of T4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect [more info...] Chain information for 248l #303 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 248l #303 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues more than 3.0 Angstroms away. Alignment of 248l chain A to query has RMSD 0.908 using 45 of 125 paired residues within cutoff distance 2.0 246l title: The response of T4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect [more info...] Chain information for 246l #304 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 246l #304 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues more than 3.0 Angstroms away. Alignment of 246l chain A to query has RMSD 0.973 using 48 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l0k from http://files.rcsb.org/download/1l0k.cif 1l0k title: Methionine core mutant of T4 lysozyme [more info...] Chain information for 1l0k #305 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-162 Non-standard residues in 1l0k #305 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 51 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l0k chain A to query has RMSD 0.938 using 41 of 122 paired residues within cutoff distance 2.0 1d3f title: N-terminal domain core methionine mutation [more info...] Chain information for 1d3f #306 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1d3f #306 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 51 non-polymer residues more than 3.0 Angstroms away. Alignment of 1d3f chain A to query has RMSD 0.99 using 48 of 125 paired residues within cutoff distance 2.0 1c60 title: T4 lysozyme mutant C54T/C97A/F153A In the presence of 8 atm argon [more info...] Chain information for 1c60 #307 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164 Non-standard residues in 1c60 #307 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues more than 3.0 Angstroms away. Alignment of 1c60 chain A to query has RMSD 1.02 using 49 of 125 paired residues within cutoff distance 2.0 165l title: Control of enzyme activity by an engineered disulfide bond [more info...] Chain information for 165l #308 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 165l #308 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues more than 3.0 Angstroms away. Alignment of 165l chain A to query has RMSD 0.994 using 48 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 6d9m from http://files.rcsb.org/download/6d9m.cif Fetching CCD GMP from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/GMP/GMP.cif Fetching CCD GTP from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/GTP/GTP.cif Fetching CCD POP from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/POP/POP.cif 6d9m title: T4-Lysozyme fusion to Geobacter GGDEF [more info...] Chain information for 6d9m #309 --- Chain | Description | UniProt A | Fusion protein of Endolysin,Response receiver sensor diguanylate cyclase, GAF domain-containing | D9IEF7_BPT4 -162--2, Q39UD1_GEOMG 1-166 Non-standard residues in 6d9m #309 --- ACT — acetate ion GMP — guanosine GOL — glycerol (glycerin; propane-1,2,3-triol) GTP — guanosine-5'-triphosphate MG — magnesium ion POP — pyrophosphate 2- 196 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 2577 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 173 C-terminal residues, 2 N-terminal residues, 301 non-polymer residues more than 3.0 Angstroms away. Alignment of 6d9m chain A to query has RMSD 1.3 using 57 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 5v83 from http://files.rcsb.org/download/5v83.cif Fetching CCD 8Z7 from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/7/8Z7/8Z7.cif 5v83 title: Structure of DCN1 bound to NAcM-HIT [more info...] Chain information for 5v83 #310 --- Chain | Description | UniProt A | Lysozyme,DCN1-like protein 1 chimera | D9IEF7_BPT4 1-164, DCNL1_HUMAN 1062-1259 Non-standard residues in 5v83 #310 --- 8Z7 — N-(1-benzylpiperidin-4-yl)-N'-[3-(trifluoromethyl)phenyl]urea 2925 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 199 C-terminal residues, 14 N-terminal residues, 198 non-polymer residues more than 3.0 Angstroms away. Alignment of 5v83 chain A to query has RMSD 1.22 using 64 of 121 paired residues within cutoff distance 2.0 5jww title: T4 Lysozyme L99A/M102Q with 1-Hydro-2-ethyl-1,2-azaborine Bound [more info...] Chain information for 5jww #311 --- Chain | Description | UniProt A | Endolysin | ENLYS_BPT4 1-164 Non-standard residues in 5jww #311 --- 6OQ — 2-ethyl-1,2-dihydro-1,2-azaborinine CL — chloride ion 95 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 8 C-terminal residues, 2 N-terminal residues, 162 non-polymer residues more than 3.0 Angstroms away. Alignment of 5jww chain A to query has RMSD 0.963 using 43 of 122 paired residues within cutoff distance 2.0 1l25 title: Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter protein stability [more info...] Chain information for 1l25 #312 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 82 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l25 chain A to query has RMSD 1.08 using 49 of 125 paired residues within cutoff distance 2.0 198l title: Thermodynamic and structural compensation In ""size-switch"" core-repacking variants of T4 lysozyme [more info...] Chain information for 198l #313 --- Chain | Description | UniProt A | LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 198l #313 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 81 non-polymer residues more than 3.0 Angstroms away. Alignment of 198l chain A to query has RMSD 0.988 using 50 of 125 paired residues within cutoff distance 2.0 149l title: Conservation of solvent-binding sites In 10 crystal forms of T4 lysozyme [more info...] Chain information for 149l #314 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 15 non-polymer residues more than 3.0 Angstroms away. Alignment of 149l chain A to query has RMSD 1.35 using 63 of 124 paired residues within cutoff distance 2.0 5x33 title: Leukotriene B4 receptor BLT1 in complex with BIIL260 [more info...] Chain information for 5x33 #315 --- Chain | Description | UniProt A | LTB4 receptor,Lysozyme,LTB4 receptor | Q9WTK1_CAVPO 15-213 214-348, A0A097J792_BPT4 1002-1161 Non-standard residues in 5x33 #315 --- 7Y9 — 4-[[3-[[4-[2-(4-hydroxyphenyl)propan-2-yl]phenoxy]methyl]phenyl]methoxy]benzenecarboximidamide 3375 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 83 C-terminal residues, 186 N-terminal residues, 1 non-polymer residues more than 3.0 Angstroms away. Alignment of 5x33 chain A to query has RMSD 1.08 using 53 of 141 paired residues within cutoff distance 2.0 221l title: The energetic cost and the structural consequences of burying A hydroxyl group within the core of A protein determined from ala to ser and val to THR substitutions In T4 lysozyme [more info...] Chain information for 221l #316 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 221l #316 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 54 non-polymer residues more than 3.0 Angstroms away. Alignment of 221l chain A to query has RMSD 1 using 49 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l68 from http://files.rcsb.org/download/1l68.cif 1l68 title: Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A polyalanine α-helix containing ten consecutive alanines [more info...] Chain information for 1l68 #317 --- Chain | Description | UniProt A | LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l68 #317 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l68 chain A to query has RMSD 0.936 using 47 of 125 paired residues within cutoff distance 2.0 1l27 title: Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter protein stability [more info...] Chain information for 1l27 #318 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l27 chain A to query has RMSD 1 using 47 of 127 paired residues within cutoff distance 2.0 1g1w title: T4 lysozyme mutant C54T/C97A/Q105M [more info...] Chain information for 1g1w #319 --- Chain | Description | UniProt A | LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1g1w #319 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues more than 3.0 Angstroms away. Alignment of 1g1w chain A to query has RMSD 1.03 using 49 of 127 paired residues within cutoff distance 2.0 1cup title: Methionine core mutant of T4 lysozyme [more info...] Chain information for 1cup #320 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1cup #320 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues more than 3.0 Angstroms away. Alignment of 1cup chain A to query has RMSD 1.03 using 49 of 125 paired residues within cutoff distance 2.0 6iih title: crystal structure of mitochondrial calcium uptake 2(MICU2) [more info...] Chain information for 6iih #321 --- Chain | Description | UniProt A B | Endolysin,Calcium uptake protein 2, mitochondrial | ENLYS_BPT4 1-161, MICU2_HUMAN 164-485 Non-standard residues in 6iih #321 --- CA — calcium ion Deleted 1 extra chains, 293 C-terminal residues, 2 N-terminal residues, 675 non-polymer residues more than 3.0 Angstroms away. Alignment of 6iih chain A to query has RMSD 0.865 using 44 of 124 paired residues within cutoff distance 2.0 210l title: Protein structure plasticity exemplified by insertion and deletion mutants In T4 lysozyme [more info...] Chain information for 210l #322 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 210l #322 --- HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues more than 3.0 Angstroms away. Alignment of 210l chain A to query has RMSD 0.947 using 45 of 127 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l71 from http://files.rcsb.org/download/1l71.cif 1l71 title: Multiple stabilizing alanine replacements within α-helix 126-134 of T4 lysozyme have independent, additive effects on both structure and stability [more info...] Chain information for 1l71 #323 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l71 #323 --- BME — β-mercaptoethanol CL — chloride ion Deleted 7 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l71 chain A to query has RMSD 1.03 using 48 of 127 paired residues within cutoff distance 2.0 1cv0 title: T4 lysozyme mutant F104M [more info...] Chain information for 1cv0 #324 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1cv0 #324 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues more than 3.0 Angstroms away. Alignment of 1cv0 chain A to query has RMSD 1.02 using 49 of 125 paired residues within cutoff distance 2.0 1c67 title: T4 lysozyme mutant C54T/C97A/L121A/L133A In the presence of 8 atm krypton [more info...] Chain information for 1c67 #325 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164 Non-standard residues in 1c67 #325 --- BME — β-mercaptoethanol CL — chloride ion KR — krypton Deleted 9 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues more than 3.0 Angstroms away. Alignment of 1c67 chain A to query has RMSD 1.09 using 50 of 125 paired residues within cutoff distance 2.0 175l title: Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme [more info...] Chain information for 175l #326 --- Chain | Description | UniProt A B | T4 LYSOZYME | LYS_BPT4 1-164 175l mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 65 non- polymer residues more than 3.0 Angstroms away. Alignment of 175l chain A to query has RMSD 0.951 using 47 of 128 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 170l from http://files.rcsb.org/download/170l.cif 170l title: Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme [more info...] Chain information for 170l #327 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 170l #327 --- BME — β-mercaptoethanol Deleted 11 C-terminal residues, 2 N-terminal residues, 6 non-polymer residues more than 3.0 Angstroms away. Alignment of 170l chain A to query has RMSD 0.917 using 45 of 125 paired residues within cutoff distance 2.0 142l title: Role of backbone flexibility In the accommodation of variants that repack the core of T4 lysozyme [more info...] Chain information for 142l #328 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 142l #328 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 48 non-polymer residues more than 3.0 Angstroms away. Alignment of 142l chain A to query has RMSD 1.07 using 49 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 3vw7 from http://files.rcsb.org/download/3vw7.cif Fetching CCD VPX from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/X/VPX/VPX.cif 3vw7 title: Crystal structure of human protease-activated receptor 1 (PAR1) bound with antagonist vorapaxar at 2.2 angstrom [more info...] Chain information for 3vw7 #329 --- Chain | Description | UniProt A | Proteinase-activated receptor 1, Lysozyme | PAR1_HUMAN 86-301 303-395, LYS_BPT4 1002-1161 Non-standard residues in 3vw7 #329 --- CL — chloride ion NA — sodium ion OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) VPX — ethyl [(1R,3aR,4aR,6R,8aR,9S,9aS)-9-{(E)-2-[5-(3-fluorophenyl)pyridin-2-yl]ethenyl}-1-methyl-3-oxododecahydronaphtho[2,3-c]fur an-6-yl]carbamate (vorapaxar) 3 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 3817 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 84 C-terminal residues, 207 N-terminal residues, 80 non-polymer residues more than 3.0 Angstroms away. Alignment of 3vw7 chain A to query has RMSD 1.34 using 58 of 125 paired residues within cutoff distance 2.0 3c83 title: Bacteriophage T4 lysozyme mutant D89A in wildtype background at room temperature [more info...] Chain information for 3c83 #330 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 3c83 #330 --- BME — β-mercaptoethanol CL — chloride ion 18 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues more than 3.0 Angstroms away. Alignment of 3c83 chain A to query has RMSD 0.962 using 47 of 125 paired residues within cutoff distance 2.0 2ou8 title: Structure of Spin-labeled T4 Lysozyme Mutant T115R1 at Room Temperature [more info...] Chain information for 2ou8 #331 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 2ou8 #331 --- BME — β-mercaptoethanol MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate (MTSL) 13 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 46 non-polymer residues more than 3.0 Angstroms away. Alignment of 2ou8 chain A to query has RMSD 1.01 using 48 of 125 paired residues within cutoff distance 2.0 1l91 title: Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4 lysozyme have different structural and thermodynamic consequences [more info...] Chain information for 1l91 #332 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l91 #332 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l91 chain A to query has RMSD 1 using 48 of 125 paired residues within cutoff distance 2.0 1l76 title: Tolerance of T4 lysozyme to proline substitutions within the long interdomain α-helix illustrates the adaptability of proteins to potentially destabilizing lesions [more info...] Chain information for 1l76 #333 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l76 #333 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l76 chain A to query has RMSD 0.95 using 44 of 124 paired residues within cutoff distance 2.0 1l24 title: Enhanced protein thermostability from site-directed mutations that decrease the entropy of unfolding [more info...] Chain information for 1l24 #334 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l24 chain A to query has RMSD 1.05 using 50 of 125 paired residues within cutoff distance 2.0 228l title: Generating ligand binding sites In T4 lysozyme using deficiency-creating substitutions [more info...] Chain information for 228l #335 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 228l #335 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues more than 3.0 Angstroms away. Alignment of 228l chain A to query has RMSD 0.952 using 47 of 125 paired residues within cutoff distance 2.0 1xep title: Catechol in complex with T4 lysozyme L99A/M102Q [more info...] Chain information for 1xep #336 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 1xep #336 --- BME — β-mercaptoethanol CAQ — catechol (1,2-dihydroxybenzene) PO4 — phosphate ion 80 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 9 C-terminal residues, 2 N-terminal residues, 140 non-polymer residues more than 3.0 Angstroms away. Alignment of 1xep chain A to query has RMSD 0.943 using 45 of 125 paired residues within cutoff distance 2.0 1l46 title: Cumulative site-directed charge-change replacements In bacteriophage T4 lysozyme suggest that long-range electrostatic interactions contribute little to protein stability [more info...] Chain information for 1l46 #337 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 79 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l46 chain A to query has RMSD 0.981 using 47 of 127 paired residues within cutoff distance 2.0 1l20 title: Enhanced protein thermostability from designed mutations that interact with α-helix dipoles [more info...] Chain information for 1l20 #338 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l20 chain A to query has RMSD 0.993 using 47 of 124 paired residues within cutoff distance 2.0 1l03 title: Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of phage T4 lysozyme [more info...] Chain information for 1l03 #339 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l03 #339 --- BME — β-mercaptoethanol Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l03 chain A to query has RMSD 1.03 using 49 of 125 paired residues within cutoff distance 2.0 1dyg title: Determination of α-helix propensity within the context of A folded protein: sites 44 and 131 In bacteriophage T4 lysozyme [more info...] Chain information for 1dyg #340 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1dyg #340 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues more than 3.0 Angstroms away. Alignment of 1dyg chain A to query has RMSD 0.938 using 45 of 127 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 157l from http://files.rcsb.org/download/157l.cif 157l title: Control of enzyme activity by an engineered disulfide bond [more info...] Chain information for 157l #341 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 157l #341 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues more than 3.0 Angstroms away. Alignment of 157l chain A to query has RMSD 0.978 using 47 of 127 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 6xyr from http://files.rcsb.org/download/6xyr.cif 6xyr title: Structure of the T4Lnano fusion protein [more info...] Chain information for 6xyr #342 --- Chain | Description | UniProt A | T4Lnano,Endolysin,Calmodulin,Endolysin,Calmodulin-1 | ENLYS_BPT4 37-199, CALM1_HUMAN 214-361 Non-standard residues in 6xyr #342 --- CA — calcium ion CL — chloride ion GOL — glycerol (glycerin; propane-1,2,3-triol) Deleted 163 C-terminal residues, 34 N-terminal residues, 75 non-polymer residues more than 3.0 Angstroms away. Alignment of 6xyr chain A to query has RMSD 1.1 using 52 of 124 paired residues within cutoff distance 2.0 222l title: Generating ligand binding sites In T4 lysozyme using deficiency-creating substitutions [more info...] Chain information for 222l #343 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 222l #343 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues more than 3.0 Angstroms away. Alignment of 222l chain A to query has RMSD 1.02 using 49 of 125 paired residues within cutoff distance 2.0 174l title: Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme [more info...] Chain information for 174l #344 --- Chain | Description | UniProt A B | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 174l #344 --- SO4 — sulfate ion 174l mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 5 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 32 non- polymer residues more than 3.0 Angstroms away. Alignment of 174l chain B to query has RMSD 1.31 using 77 of 128 paired residues within cutoff distance 2.0 6p5w title: Structure of DCN1 bound to 3-methyl-N-((4S,5S)-3-methyl-6-oxo-1-phenyl-4-(p-tolyl)-4,5,6,7-tetrahydro-1H-pyrazolo[3,4-b]pyridin-5-yl)benzamide [more info...] Chain information for 6p5w #345 --- Chain | Description | UniProt A | Lysozyme,DCN1-like protein 1 chimera | D9IEF7_BPT4 1-164, DCNL1_HUMAN 1062-1259 Non-standard residues in 6p5w #345 --- O0A — 3-methyl-N-[(4S,5S)-3-methyl-4-(4-methylphenyl)-6-oxo-1-phenyl-4,5,6,7-tetrahydro-1H-pyrazolo[3,4-b]pyridin-5-yl]benzamide 2996 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 204 C-terminal residues, 15 N-terminal residues, 200 non-polymer residues more than 3.0 Angstroms away. Alignment of 6p5w chain A to query has RMSD 1.11 using 55 of 121 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 6fw2 from http://files.rcsb.org/download/6fw2.cif Fetching CCD MOO from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/O/MOO/MOO.cif 6fw2 title: Crystal Structure of human mARC1 [more info...] Chain information for 6fw2 #346 --- Chain | Description | UniProt A | Mitochondrial amidoxime-reducing component 1,Endolysin,Mitochondrial amidoxime-reducing component 1 | MARC1_HUMAN 53-128 131-336, D9IEF7_BPT4 1001-1161 Non-standard residues in 6fw2 #346 --- B3P — 2-[3-(2-hydroxy-1,1-dihydroxymethyl- ethylamino)-propylamino]-2-hydroxymethyl-propane-1,3-diol EFK — oxidanyl(oxidanylidene)molybdenum MOO — molybdate ion (molybdate) MTE — phosphonic acidmono-(2-amino-5,6-dimercapto-4-oxo-3,7,8A,9,10,10A-hexahydro-4H-8-oxa-1,3,9,10-tetraaza- anthracen-7-ylmethyl)ester PO4 — phosphate ion 53 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 214 C-terminal residues, 79 N-terminal residues, 340 non-polymer residues more than 3.0 Angstroms away. Alignment of 6fw2 chain A to query has RMSD 0.933 using 47 of 127 paired residues within cutoff distance 2.0 256l title: Bacteriophage T4 lysozyme [more info...] Chain information for 256l #347 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues more than 3.0 Angstroms away. Alignment of 256l chain A to query has RMSD 1.02 using 48 of 125 paired residues within cutoff distance 2.0 247l title: The response of T4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect [more info...] Chain information for 247l #348 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 247l #348 --- CL — chloride ion HED — 2-hydroxyethyl disulfide 1 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues more than 3.0 Angstroms away. Alignment of 247l chain A to query has RMSD 0.961 using 46 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 242l from http://files.rcsb.org/download/242l.cif 242l title: The response of T4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect [more info...] Chain information for 242l #349 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 242l #349 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 11 C-terminal residues, 2 N-terminal residues, 87 non-polymer residues more than 3.0 Angstroms away. Alignment of 242l chain A to query has RMSD 0.994 using 48 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1l94 from http://files.rcsb.org/download/1l94.cif 1l94 title: Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4 lysozyme have different structural and thermodynamic consequences [more info...] Chain information for 1l94 #350 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1l94 #350 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l94 chain A to query has RMSD 1.04 using 49 of 125 paired residues within cutoff distance 2.0 1cu0 title: T4 lysozyme mutant I78M [more info...] Chain information for 1cu0 #351 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1cu0 #351 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues more than 3.0 Angstroms away. Alignment of 1cu0 chain A to query has RMSD 1.02 using 47 of 123 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 150l from http://files.rcsb.org/download/150l.cif 150l title: Conservation of solvent-binding sites In 10 crystal forms of T4 lysozyme [more info...] Chain information for 150l #352 --- Chain | Description | UniProt A B C D | T4 LYSOZYME | LYS_BPT4 1-164 150l mmCIF Assemblies --- 1| author_defined_assembly 2| author_and_software_defined_assembly 3| author_defined_assembly 4| author_and_software_defined_assembly Deleted 3 extra chains, 9 C-terminal residues, 3 N-terminal residues, 155 non- polymer residues more than 3.0 Angstroms away. Alignment of 150l chain B to query has RMSD 1.4 using 59 of 124 paired residues within cutoff distance 2.0 5wf5 title: Agonist bound human A2a adenosine receptor with D52N mutation at 2.60 A resolution [more info...] Chain information for 5wf5 #353 --- Chain | Description | UniProt A | Human A2a adenosine receptor T4L chimera | AA2AR_HUMAN 2-208 222-316, ENLYS_BPT4 1002-1161 Non-standard residues in 5wf5 #353 --- OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) UKA — 6-(2,2-diphenylethylamino)-9-[(2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxy- oxolan-2-yl]-N-[2-[(1-pyridin-2-ylpiperidin-4-yl)carbamoylamino]ethyl]purine-2-carboxamide 17 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 94 C-terminal residues, 199 N-terminal residues, 4 non-polymer residues more than 3.0 Angstroms away. Alignment of 5wf5 chain A to query has RMSD 1.18 using 60 of 121 paired residues within cutoff distance 2.0 1lyh title: Dissection of helix capping In T4 lysozyme by structural and thermodynamic analysis of six amino acid substitutions At THR 59 [more info...] Chain information for 1lyh #354 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 1lyh #354 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues more than 3.0 Angstroms away. Alignment of 1lyh chain A to query has RMSD 0.99 using 48 of 125 paired residues within cutoff distance 2.0 1l69 title: Multiple stabilizing alanine replacements within α-helix 126-134 of T4 lysozyme have independent, additive effects on both structure and stability [more info...] Chain information for 1l69 #355 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1l69 #355 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l69 chain A to query has RMSD 1.07 using 48 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 173l from http://files.rcsb.org/download/173l.cif 173l title: Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme [more info...] Chain information for 173l #356 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 173l #356 --- BME — β-mercaptoethanol Deleted 9 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues more than 3.0 Angstroms away. Alignment of 173l chain A to query has RMSD 1.35 using 68 of 124 paired residues within cutoff distance 2.0 141l title: Role of backbone flexibility In the accommodation of variants that repack the core of T4 lysozyme [more info...] Chain information for 141l #357 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 141l #357 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 54 non-polymer residues more than 3.0 Angstroms away. Alignment of 141l chain A to query has RMSD 1.08 using 48 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 7mwz from http://files.rcsb.org/download/7mwz.cif Fetching CCD 4UR from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/R/4UR/4UR.cif 7mwz title: Structure of drosophila STING in complex with 3'2'-cGAMP [more info...] Chain information for 7mwz #358 --- Chain | Description A B C D | STING Non-standard residues in 7mwz #358 --- 4UR — 3'2'-cGAMP (2-amino-9-[(2S,5R,7R,8R,10R,12aR,14R,15R,15aS,16R)-7-(6-amino-9H-purin-9-yl)-2,10,15,16-tetrahydroxy-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2-l][1,3,6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl]-1,9-dihydro-6H-purin-6-one) 7mwz mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 10943 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 3 extra chains, 197 C-terminal residues, 3 N-terminal residues, 473 non-polymer residues more than 3.0 Angstroms away. Alignment of 7mwz chain A to query has RMSD 1.11 using 58 of 124 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 6ffh from http://files.rcsb.org/download/6ffh.cif Fetching CCD D7W from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/W/D7W/D7W.cif Fetching CCD YCM from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/M/YCM/YCM.cif 6ffh title: Crystal Structure of mGluR5 in complex with Fenobam at 2.65 A [more info...] Chain information for 6ffh #359 --- Chain | Description | UniProt A | Metabotropic glutamate receptor 5,Endolysin | GRM5_HUMAN 569-678 1679-1836, ENLYS_BPT4 1002-1161 Non-standard residues in 6ffh #359 --- D7W — 1-(3-chlorophenyl)-3-(3-methyl-5-oxidanylidene-4~{H}-imidazol-2-yl)urea MES — 2-(N-morpholino)-ethanesulfonic acid OLA — oleic acid OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) 3307 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 151 C-terminal residues, 112 N-terminal residues, 16 non-polymer residues more than 3.0 Angstroms away. Alignment of 6ffh chain A to query has RMSD 1.18 using 65 of 126 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 3sb7 from http://files.rcsb.org/download/3sb7.cif 3sb7 title: Cu-mediated Trimer of T4 Lysozyme D61H/K65H/R76H/R80H by Synthetic Symmetrization [more info...] Chain information for 3sb7 #360 --- Chain | Description | UniProt A B | Lysozyme | LYS_BPT4 1-162 Non-standard residues in 3sb7 #360 --- CU — copper (II) ion GOL — glycerol (glycerin; propane-1,2,3-triol) 3sb7 mmCIF Assemblies --- 1| author_defined_assembly 2| author_and_software_defined_assembly 2579 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 9 C-terminal residues, 3 N-terminal residues, 24 non- polymer residues more than 3.0 Angstroms away. Alignment of 3sb7 chain A to query has RMSD 0.967 using 44 of 124 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1cu3 from http://files.rcsb.org/download/1cu3.cif 1cu3 title: T4 lysozyme mutant V87M [more info...] Chain information for 1cu3 #361 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1cu3 #361 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues more than 3.0 Angstroms away. Alignment of 1cu3 chain A to query has RMSD 1.01 using 47 of 125 paired residues within cutoff distance 2.0 3oe0 title: Crystal structure of the CXCR4 chemokine receptor in complex with a cyclic peptide antagonist CVX15 [more info...] Chain information for 3oe0 #362 --- Chain | Description | UniProt A | C-X-C chemokine receptor type 4, Lysozyme Chimera | CXCR4_HUMAN 2-228 231-319, LYS_BPT4 1002-1161 I | Polyphemusin analog, CXC chemokine receptor antagonist | 3oe0 mmCIF Assemblies --- 1| author_defined_assembly 3484 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 81 C-terminal residues, 197 N-terminal residues, 5 non-polymer residues more than 3.0 Angstroms away. Alignment of 3oe0 chain A to query has RMSD 1.02 using 55 of 131 paired residues within cutoff distance 2.0 250l title: The response of T4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect [more info...] Chain information for 250l #363 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 250l #363 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues more than 3.0 Angstroms away. Alignment of 250l chain A to query has RMSD 0.938 using 46 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 209l from http://files.rcsb.org/download/209l.cif 209l title: Protein structure plasticity exemplified by insertion and deletion mutants In T4 lysozyme [more info...] Chain information for 209l #364 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 8 C-terminal residues, 2 N-terminal residues, 11 non-polymer residues more than 3.0 Angstroms away. Alignment of 209l chain A to query has RMSD 1.01 using 48 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1p37 from http://files.rcsb.org/download/1p37.cif 1p37 title: T4 lysozyme core repacking back-revertant L102M/CORE10 [more info...] Chain information for 1p37 #365 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1p37 #365 --- CL — chloride ion HED — 2-hydroxyethyl disulfide K — potassium ion 14 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 11 C-terminal residues, 2 N-terminal residues, 118 non-polymer residues more than 3.0 Angstroms away. Alignment of 1p37 chain A to query has RMSD 0.93 using 45 of 127 paired residues within cutoff distance 2.0 1l45 title: Cumulative site-directed charge-change replacements In bacteriophage T4 lysozyme suggest that long-range electrostatic interactions contribute little to protein stability [more info...] Chain information for 1l45 #366 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l45 chain A to query has RMSD 1.01 using 48 of 125 paired residues within cutoff distance 2.0 1c6b title: T4 lysozyme mutant C54T/C97A/L133A In the presence of 8 atm xenon [more info...] Chain information for 1c6b #367 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 Non-standard residues in 1c6b #367 --- BME — β-mercaptoethanol CL — chloride ion XE — XENON Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues more than 3.0 Angstroms away. Alignment of 1c6b chain A to query has RMSD 1.03 using 48 of 125 paired residues within cutoff distance 2.0 4rws title: Crystal structure of CXCR4 and viral chemokine antagonist vMIP-II complex (PSI Community Target) [more info...] Chain information for 4rws #368 --- Chain | Description | UniProt A | C-X-C chemokine receptor type 4/Endolysin chimeric protein | CXCR4_HUMAN 2-228 231-319, LYS_BPT4 1002-1161 C | Viral macrophage inflammatory protein 2 | VMI2_HHV8P 1-71 3953 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 84 C-terminal residues, 200 N-terminal residues. Alignment of 4rws chain A to query has RMSD 1.05 using 54 of 126 paired residues within cutoff distance 2.0 244l title: The response of T4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect [more info...] Chain information for 244l #369 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 244l #369 --- BME — β-mercaptoethanol CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues more than 3.0 Angstroms away. Alignment of 244l chain A to query has RMSD 0.971 using 48 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 6kk7 from http://files.rcsb.org/download/6kk7.cif Fetching CCD 97Y from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/Y/97Y/97Y.cif 6kk7 title: Structure of thermal-stabilised(M6) human GLP-1 receptor transmembrane domain [more info...] Chain information for 6kk7 #370 --- Chain | Description | UniProt A B | Glucagon-like peptide 1 receptor,Endolysin,Glucagon-like peptide 1 receptor | GLP1R_HUMAN 128-257 261-431, ENLYS_BPT4 1001-1160 Non-standard residues in 6kk7 #370 --- 97Y — N-{4-[(R)-(3,3-dimethylcyclobutyl)({6-[4-(trifluoromethyl)-1H-imidazol-1-yl]pyridin-3-yl}amino)methyl]benzene-1-carbonyl}-beta- alanine 6kk7 mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 6590 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 162 C-terminal residues, 95 N-terminal residues, 2 non-polymer residues more than 3.0 Angstroms away. Alignment of 6kk7 chain B to query has RMSD 0.929 using 46 of 142 paired residues within cutoff distance 2.0 1l37 title: Contributions of engineered surface salt bridges to the stability of T4 lysozyme determined by directed mutagenesis [more info...] Chain information for 1l37 #371 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l37 chain A to query has RMSD 0.955 using 46 of 125 paired residues within cutoff distance 2.0 1d2w title: N-terminal domain core methionine mutation [more info...] Chain information for 1d2w #372 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1d2w #372 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues more than 3.0 Angstroms away. Alignment of 1d2w chain A to query has RMSD 0.959 using 47 of 127 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1quo from http://files.rcsb.org/download/1quo.cif 1quo title: L99A/E108V mutant of T4 lysozyme [more info...] Chain information for 1quo #373 --- Chain | Description | UniProt A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162 Non-standard residues in 1quo #373 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 50 non-polymer residues more than 3.0 Angstroms away. Alignment of 1quo chain A to query has RMSD 1.02 using 49 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 6xc1 from http://files.rcsb.org/download/6xc1.cif 6xc1 title: Crystal structure of bacteriophage T4 spackle and lysozyme in orthorhombic form [more info...] Chain information for 6xc1 #374 --- Chain | Description | UniProt A | Lysozyme | BP5_BPT4 174-342 C | Protein spackle | SPAC_BPT4 1-97 Non-standard residues in 6xc1 #374 --- EDO — 1,2-ethanediol (ethylene glycol) IPA — isopropyl alcohol (2-propanol) 36 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 1923 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 10 C-terminal residues, 1 N-terminal residues, 74 non- polymer residues more than 3.0 Angstroms away. Alignment of 6xc1 chain A to query has RMSD 1.36 using 51 of 127 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 5zty from http://files.rcsb.org/download/5zty.cif Fetching CCD 9JU from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/U/9JU/9JU.cif Fetching CCD PG4 from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/4/PG4/PG4.cif 5zty title: Crystal structure of human G protein coupled receptor [more info...] Chain information for 5zty #375 --- Chain | Description | UniProt A | G protein coupled receptor,T4 lysozyme,G protein coupled receptor | CNR2_HUMAN 21-222 235-325, D9IEF7_BPT4 1001-1160 Non-standard residues in 5zty #375 --- 9JU — N-(adamantan-1-yl)-1-(5-hydroxypentyl)-4-methyl-5-phenyl-1H-pyrazole-3-carboxamide EPE — 4-(2-hydroxyethyl)-1-piperazine ethanesulfonic acid (HEPES) OLA — oleic acid OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) PEG — di(hydroxyethyl)ether PG4 — tetraethylene glycol SO4 — sulfate ion 15 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 3508 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 93 C-terminal residues, 200 N-terminal residues, 48 non-polymer residues more than 3.0 Angstroms away. Alignment of 5zty chain A to query has RMSD 1.11 using 44 of 127 paired residues within cutoff distance 2.0 1xju title: Crystal structure of secreted inactive form of P1 phage endolysin Lyz [more info...] Chain information for 1xju #376 --- Chain | Description | UniProt A B | Lysozyme | LYS_BPP1 29-185 Non-standard residues in 1xju #376 --- SO4 — sulfate ion 1xju mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 3| software_defined_assembly Deleted 1 extra chains, 8 C-terminal residues, 35 N-terminal residues, 469 non-polymer residues more than 3.0 Angstroms away. Alignment of 1xju chain A to query has RMSD 0.97 using 63 of 101 paired residues within cutoff distance 2.0 1owz title: T4 Lysozyme Cavity Mutant L99A/M102Q Bound With 4-FluoroPhenEthyl Alcohol [more info...] Chain information for 1owz #377 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 1owz #377 --- 4FA — 4-fluorophenethyl alcohol BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 19 non-polymer residues more than 3.0 Angstroms away. Alignment of 1owz chain A to query has RMSD 0.974 using 44 of 122 paired residues within cutoff distance 2.0 7e40 title: Mechanism of Phosphate Sensing and Signaling Revealed by Rice SPX1-PHR2 Complex Structure [more info...] Chain information for 7e40 #378 --- Chain | Description | UniProt A C | Protein PHOSPHATE STARVATION RESPONSE 2 | PHR2_ORYSJ 248-380 B D | SPX domain-containing protein 1,Endolysin | SPX1_ORYSJ 1-198, D9IEF7_BPT4 199-357 Non-standard residues in 7e40 #378 --- IHP — inositol hexakisphosphate (myo-inositol hexakisphosphate; inositol 1,2,3,4,5,6-hexakisphosphate) 7e40 mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 7193 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 3 extra chains, 8 C-terminal residues, 137 N-terminal residues, 14 non-polymer residues more than 3.0 Angstroms away. Alignment of 7e40 chain B to query has RMSD 1.27 using 61 of 158 paired residues within cutoff distance 2.0 4n9n title: Crystal Structure of Saccharomyces cerevisiae Upc2 Transcription Factor fused with T4 Lysozyme [more info...] Chain information for 4n9n #379 --- Chain | Description | UniProt A B | Sterol uptake control protein 2, Lysozyme | UPC2_YEAST 598-714 726-878, LYS_BPT4 1002-1161 Deleted 1 extra chains, 163 C-terminal residues, 112 N-terminal residues, 24 non-polymer residues more than 3.0 Angstroms away. Alignment of 4n9n chain A to query has RMSD 1.24 using 69 of 122 paired residues within cutoff distance 2.0 4evx title: Crystal structure of putative phage endolysin from S. enterica [more info...] Chain information for 4evx #380 --- Chain | Description | UniProt A B | Putative phage endolysin | Q8ZLC6_SALTY 5-107 4evx mmCIF Assemblies --- 1| software_defined_assembly 2| software_defined_assembly 3| software_defined_assembly 4| software_defined_assembly 37 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 1570 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 63 non- polymer residues more than 3.0 Angstroms away. Alignment of 4evx chain A to query has RMSD 0.878 using 43 of 85 paired residues within cutoff distance 2.0 3oe8 title: Crystal structure of the CXCR4 chemokine receptor in complex with a small molecule antagonist IT1t in P1 spacegroup [more info...] Chain information for 3oe8 #381 --- Chain | Description | UniProt A B C | C-X-C chemokine receptor type 4, Lysozyme Chimera | CXCR4_HUMAN 2-229 230-319, LYS_BPT4 1002-1161 Non-standard residues in 3oe8 #381 --- ITD — (6,6-dimethyl-5,6-dihydroimidazo[2,1-b][1,3]thiazol-3-yl)methyl N,N'-dicyclohexylimidothiocarbamate 3oe8 mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| software_defined_assembly 3| software_defined_assembly 10292 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 2 extra chains, 82 C-terminal residues, 198 N-terminal residues, 3 non-polymer residues more than 3.0 Angstroms away. Alignment of 3oe8 chain A to query has RMSD 1.02 using 48 of 124 paired residues within cutoff distance 2.0 1xju title: Crystal structure of secreted inactive form of P1 phage endolysin Lyz [more info...] Chain information for 1xju #382 --- Chain | Description | UniProt A B | Lysozyme | LYS_BPP1 29-185 Non-standard residues in 1xju #382 --- SO4 — sulfate ion 1xju mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 3| software_defined_assembly Deleted 1 extra chains, 8 C-terminal residues, 429 non-polymer residues more than 3.0 Angstroms away. Alignment of 1xju chain B to query has RMSD 0.983 using 72 of 125 paired residues within cutoff distance 2.0 1cvk title: T4 lysozyme mutant L118A [more info...] Chain information for 1cvk #383 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-164 Non-standard residues in 1cvk #383 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues more than 3.0 Angstroms away. Alignment of 1cvk chain A to query has RMSD 0.993 using 48 of 125 paired residues within cutoff distance 2.0 143l title: Role of backbone flexibility In the accommodation of variants that repack the core of T4 lysozyme [more info...] Chain information for 143l #384 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 143l #384 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 49 non-polymer residues more than 3.0 Angstroms away. Alignment of 143l chain A to query has RMSD 1.05 using 50 of 125 paired residues within cutoff distance 2.0 1l51 title: Structural and thermodynamic analysis of the packing of two α-helices In bacteriophage T4 lysozyme [more info...] Chain information for 1l51 #385 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 11 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues more than 3.0 Angstroms away. Alignment of 1l51 chain A to query has RMSD 1.03 using 46 of 127 paired residues within cutoff distance 2.0 2nth title: Structure of Spin-labeled T4 Lysozyme Mutant L118R1 [more info...] Chain information for 2nth #386 --- Chain | Description | UniProt A | Lysozyme | LYS_BPT4 1-164 Non-standard residues in 2nth #386 --- MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate (MTSL) Deleted 11 C-terminal residues, 2 N-terminal residues, 82 non-polymer residues more than 3.0 Angstroms away. Alignment of 2nth chain A to query has RMSD 0.939 using 45 of 123 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1ky1 from http://files.rcsb.org/download/1ky1.cif 1ky1 title: Methionine core mutant of T4 lysozyme [more info...] Chain information for 1ky1 #387 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-162 Non-standard residues in 1ky1 #387 --- CL — chloride ion HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 53 non-polymer residues more than 3.0 Angstroms away. Alignment of 1ky1 chain A to query has RMSD 0.893 using 42 of 121 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 4k5y from http://files.rcsb.org/download/4k5y.cif Fetching CCD PGW from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/W/PGW/PGW.cif 4k5y title: Crystal structure of human corticotropin-releasing factor receptor 1 (CRF1R) in complex with the antagonist CP-376395 [more info...] Chain information for 4k5y #388 --- Chain | Description | UniProt A B C | Corticotropin-releasing factor receptor 1, T4-Lysozyme chimeric construct | CRFR1_HUMAN 104-220 224-373, LYS_BPT4 1002-1161 Non-standard residues in 4k5y #388 --- 1PE — pentaethylene glycol (PEG400) 1Q5 — 3,6-dimethyl-N-(pentan-3-yl)-2-(2,4,6-trimethylphenoxy)pyridin-4-amine OLA — oleic acid OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) PGW — (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate (1-Palmitoyl-2-Oleoyl-sn- Glycero-3-[Phospho-(1-glycerol)]; PHOSPHATIDYLGLYCEROL) SO4 — sulfate ion 4k5y mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 3| author_defined_assembly Deleted 2 extra chains, 149 C-terminal residues, 107 N-terminal residues, 20 non-polymer residues more than 3.0 Angstroms away. Alignment of 4k5y chain A to query has RMSD 1.35 using 73 of 124 paired residues within cutoff distance 2.0 4k5y title: Crystal structure of human corticotropin-releasing factor receptor 1 (CRF1R) in complex with the antagonist CP-376395 [more info...] Chain information for 4k5y #389 --- Chain | Description | UniProt A B C | Corticotropin-releasing factor receptor 1, T4-Lysozyme chimeric construct | CRFR1_HUMAN 104-220 224-373, LYS_BPT4 1002-1161 Non-standard residues in 4k5y #389 --- 1PE — pentaethylene glycol (PEG400) 1Q5 — 3,6-dimethyl-N-(pentan-3-yl)-2-(2,4,6-trimethylphenoxy)pyridin-4-amine OLA — oleic acid OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) PGW — (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate (1-Palmitoyl-2-Oleoyl-sn- Glycero-3-[Phospho-(1-glycerol)]; PHOSPHATIDYLGLYCEROL) SO4 — sulfate ion 4k5y mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 3| author_defined_assembly Deleted 2 extra chains, 138 C-terminal residues, 107 N-terminal residues, 18 non-polymer residues more than 3.0 Angstroms away. Alignment of 4k5y chain B to query has RMSD 1.3 using 73 of 126 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 140l from http://files.rcsb.org/download/140l.cif 140l title: Role of backbone flexibility In the accommodation of variants that repack the core of T4 lysozyme [more info...] Chain information for 140l #390 --- Chain | Description | UniProt A | T4 LYSOZYME | LYCV_BPT4 1-164 Non-standard residues in 140l #390 --- BME — β-mercaptoethanol CL — chloride ion Deleted 9 C-terminal residues, 2 N-terminal residues, 50 non-polymer residues more than 3.0 Angstroms away. Alignment of 140l chain A to query has RMSD 1.02 using 48 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 4ej4 from http://files.rcsb.org/download/4ej4.cif Fetching CCD EJ4 from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/4/EJ4/EJ4.cif 4ej4 title: Structure of the δ opioid receptor bound to naltrindole [more info...] Chain information for 4ej4 #391 --- Chain | Description | UniProt A | Delta-type opioid receptor, Lysozyme chimera | OPRD_MOUSE 36-244 251-342, LYS_BPT4 1002-1161 Non-standard residues in 4ej4 #391 --- EJ4 — (4bS,8R,8aS,14bR)-7-(cyclopropylmethyl)-5,6,7,8,14,14b-hexahydro-4,8-methano[1]benzofuro[2,3-a]pyrido[4,3-b]carbazole-1,8a(9H)-diol (Naltrindole) Deleted 86 C-terminal residues, 205 N-terminal residues, 1 non-polymer residues more than 3.0 Angstroms away. Alignment of 4ej4 chain A to query has RMSD 1.06 using 51 of 125 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 1qtd from http://files.rcsb.org/download/1qtd.cif 1qtd title: The introduction of strain and its effects on the structure and stability of T4 lysozyme [more info...] Chain information for 1qtd #392 --- Chain | Description | UniProt A | LYSOZYME | LYS_BPT4 1-162 Non-standard residues in 1qtd #392 --- HED — 2-hydroxyethyl disulfide Deleted 9 C-terminal residues, 2 N-terminal residues, 26 non-polymer residues more than 3.0 Angstroms away. Alignment of 1qtd chain A to query has RMSD 1.13 using 54 of 126 paired residues within cutoff distance 2.0 4evx title: Crystal structure of putative phage endolysin from S. enterica [more info...] Chain information for 4evx #393 --- Chain | Description | UniProt A B | Putative phage endolysin | Q8ZLC6_SALTY 5-107 4evx mmCIF Assemblies --- 1| software_defined_assembly 2| software_defined_assembly 3| software_defined_assembly 4| software_defined_assembly 37 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 1570 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 5 C-terminal residues, 64 non-polymer residues more than 3.0 Angstroms away. Alignment of 4evx chain B to query has RMSD 0.853 using 41 of 89 paired residues within cutoff distance 2.0 218l title: Protein structure plasticity exemplified by insertion and deletion mutants In T4 lysozyme [more info...] Chain information for 218l #394 --- Chain | Description | UniProt A | T4 LYSOZYME | LYS_BPT4 1-164 Deleted 9 C-terminal residues, 2 N-terminal residues, 39 non-polymer residues more than 3.0 Angstroms away. Alignment of 218l chain A to query has RMSD 1.2 using 53 of 122 paired residues within cutoff distance 2.0 5zkq title: Crystal structure of the human platelet-activating factor receptor in complex with ABT-491 [more info...] Chain information for 5zkq #395 --- Chain | Description | UniProt A B | Platelet-activating factor receptor,Endolysin,Endolysin,Platelet-activating factor receptor | PTAFR_HUMAN 2-218 224-316, ENLYS_BPT4 1001-1010 1017-1117 Non-standard residues in 5zkq #395 --- 9EU — 4-ethynyl-3-{3-fluoro-4-[(2-methyl-1H-imidazo[4,5-c]pyridin-1-yl)methyl]benzene-1-carbonyl}-N,N-dimethyl-1H-indole-1-carboxamide OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) SO4 — sulfate ion ZN — zinc ion 8 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 1 extra chains, 85 C-terminal residues, 214 N-terminal residues, 16 non-polymer residues more than 3.0 Angstroms away. Alignment of 5zkq chain B to query has RMSD 1.08 using 44 of 92 paired residues within cutoff distance 2.0 3bkv title: X-ray structure of the bacteriophage phiKZ lytic transglycosylase, gp144, in complex with chitotetraose, (NAG)4 [more info...] Chain information for 3bkv #396 --- Chain | Description | UniProt A | lytic transglycosylase | Q8SD18_9CAUD 1-260 Non-standard residues in 3bkv #396 --- NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE) NI — nickel (II) ion SO4 — sulfate ion Deleted 4 C-terminal residues, 114 N-terminal residues, 6 non-polymer residues more than 3.0 Angstroms away. Alignment of 3bkv chain A to query has RMSD 1.21 using 33 of 121 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 4dqj from http://files.rcsb.org/download/4dqj.cif Fetching CCD AES from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/S/AES/AES.cif 4dqj title: Structural Investigation of Bacteriophage Phi6 Lysin (in complex with chitotetraose) [more info...] Chain information for 4dqj #397 --- Chain | Description | UniProt A B | Membrane protein Phi6 P5 | Q283U5_BPPH6 48-220 Non-standard residues in 4dqj #397 --- AES — 4-(2-aminoethyl)benzenesulfonyl fluoride (AEBSF) NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE) 4dqj mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 62 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. 2723 atoms have anisotropic B-factors. Depict anisotropic information with Thermal Ellipsoids [start tool...] or the aniso command. Deleted 1 extra chains, 4 C-terminal residues, 3 N-terminal residues, 306 non- polymer residues more than 3.0 Angstroms away. Alignment of 4dqj chain A to query has RMSD 1.38 using 28 of 112 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 4eya from http://files.rcsb.org/download/4eya.cif 4eya title: Crystal Structure of a Plectonemic RNA Supercoil [more info...] Chain information for 4eya #398 --- Chain | Description | UniProt A B C D E F G H | N utilization substance protein B homolog | NUSB_AQUAE 1-148 a b c d e f g h i j k l m n o p q r s t | RNA (5'-R(*GP*GP*CP*UP*CP*CP*UP*UP*GP*GP*CP*A)-3') | Non-standard residues in 4eya #398 --- GOL — glycerol (glycerin; propane-1,2,3-triol) SO4 — sulfate ion Deleted 27 extra chains, 10 C-terminal residues, 37 N-terminal residues, 16 non-polymer residues more than 3.0 Angstroms away. Alignment of 4eya chain A to query has RMSD 0.768 using 23 of 80 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 7ao7 from http://files.rcsb.org/download/7ao7.cif Fetching CCD HEM from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/M/HEM/HEM.cif Fetching CCD OC9 from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/9/OC9/OC9.cif 7ao7 title: Structure of CYP153A from Polaromonas sp. in complex with octan-1-ol [more info...] Chain information for 7ao7 #399 --- Chain | Description | UniProt A B C D E F | Cytochrome P450 | Q11ZY2_POLSJ 1-418 Non-standard residues in 7ao7 #399 --- HEM — protoporphyrin IX containing Fe (HEME) OC9 — octan-1-ol 7ao7 mmCIF Assemblies --- 1| author_defined_assembly 2| author_defined_assembly 3| author_defined_assembly 4| author_defined_assembly 5| author_defined_assembly 6| author_defined_assembly Deleted 5 extra chains, 98 C-terminal residues, 163 N-terminal residues, 358 non-polymer residues more than 3.0 Angstroms away. Alignment of 7ao7 chain B to query has RMSD 1.03 using 14 of 95 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 4ye9 from http://files.rcsb.org/download/4ye9.cif 4ye9 title: The crystal structure of the G45V mutant of human GlnRS [more info...] Chain information for 4ye9 #400 --- Chain | Description | UniProt A | Glutamine--tRNA ligase | SYQ_HUMAN 1-775 28 atoms have alternate locations. Control/examine alternate locations with Altloc Explorer [start tool...] or the altlocs command. Deleted 612 C-terminal residues, 15 N-terminal residues, 83 non-polymer residues more than 3.0 Angstroms away. Alignment of 4ye9 chain A to query has RMSD 0.814 using 13 of 71 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 7uqj from http://files.rcsb.org/download/7uqj.cif Fetching CCD AGS from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/S/AGS/AGS.cif 7uqj title: Cryo-EM structure of the S. cerevisiae chromatin remodeler Yta7 hexamer bound to ATPgS and histone H3 tail in state II [more info...] Chain information for 7uqj #401 --- Chain | Description | UniProt A B C D E F | ATPase histone chaperone YTA7 | ATAD2_YEAST 1-1379 G | Histone H3 | H3_YEAST 1-25 Non-standard residues in 7uqj #401 --- ADP — adenosine-5'-diphosphate AGS — phosphothiophosphoric acid-adenylate ester (atp-γ-S; adenosine 5'-(3-thiotriphosphate); adenosine 5'-(γ-thiotriphosphate); adenosine-5'-diphosphate monothiophosphate) MG — magnesium ion Deleted 6 extra chains, 315 C-terminal residues, 181 N-terminal residues, 10 non-polymer residues more than 3.0 Angstroms away. Alignment of 7uqj chain F to query has RMSD 1.29 using 25 of 79 paired residues within cutoff distance 2.0 7uqj title: Cryo-EM structure of the S. cerevisiae chromatin remodeler Yta7 hexamer bound to ATPgS and histone H3 tail in state II [more info...] Chain information for 7uqj #402 --- Chain | Description | UniProt A B C D E F | ATPase histone chaperone YTA7 | ATAD2_YEAST 1-1379 G | Histone H3 | H3_YEAST 1-25 Non-standard residues in 7uqj #402 --- ADP — adenosine-5'-diphosphate AGS — phosphothiophosphoric acid-adenylate ester (atp-γ-S; adenosine 5'-(3-thiotriphosphate); adenosine 5'-(γ-thiotriphosphate); adenosine-5'-diphosphate monothiophosphate) MG — magnesium ion Deleted 6 extra chains, 309 C-terminal residues, 187 N-terminal residues, 10 non-polymer residues more than 3.0 Angstroms away. Alignment of 7uqj chain C to query has RMSD 1.3 using 27 of 70 paired residues within cutoff distance 2.0 Fetching compressed mmCIF 3qz1 from http://files.rcsb.org/download/3qz1.cif Fetching CCD 3QZ from https://files.wwpdb.org/pub/pdb/refdata/chem_comp/Z/3QZ/3QZ.cif 3qz1 title: Crystal Structure of Bovine Steroid of 21-hydroxylase (P450c21) [more info...] Chain information for 3qz1 #403 --- Chain | Description | UniProt A B C D | Steroid 21-hydroxylase | CP21A_BOVIN 1-496 Non-standard residues in 3qz1 #403 --- 3QZ — (9beta)-17-hydroxypregn-4-ene-3,20-dione HEM — protoporphyrin IX containing Fe (HEME) 3qz1 mmCIF Assemblies --- 1| author_and_software_defined_assembly 2| author_and_software_defined_assembly 3| author_and_software_defined_assembly 4| author_and_software_defined_assembly Deleted 3 extra chains, 176 C-terminal residues, 192 N-terminal residues, 108 non-polymer residues more than 3.0 Angstroms away. Alignment of 3qz1 chain B to query has RMSD 1.04 using 15 of 67 paired residues within cutoff distance 2.0 7uqj title: Cryo-EM structure of the S. cerevisiae chromatin remodeler Yta7 hexamer bound to ATPgS and histone H3 tail in state II [more info...] Chain information for 7uqj #404 --- Chain | Description | UniProt A B C D E F | ATPase histone chaperone YTA7 | ATAD2_YEAST 1-1379 G | Histone H3 | H3_YEAST 1-25 Non-standard residues in 7uqj #404 --- ADP — adenosine-5'-diphosphate AGS — phosphothiophosphoric acid-adenylate ester (atp-γ-S; adenosine 5'-(3-thiotriphosphate); adenosine 5'-(γ-thiotriphosphate); adenosine-5'-diphosphate monothiophosphate) MG — magnesium ion Deleted 6 extra chains, 309 C-terminal residues, 184 N-terminal residues, 10 non-polymer residues more than 3.0 Angstroms away. Alignment of 7uqj chain E to query has RMSD 1.25 using 25 of 74 paired residues within cutoff distance 2.0 > select clear > close > open ""/Users/gth_book/Documents/1_JOB_Files/Research_Proj_Prop/★ > Prop_2024_Enzybiotics ▲ 🌱/Structures_Analysis/Structure > analysis/AbLys1_8APP_monom.pdb"" Chain information for AbLys1_8APP_monom.pdb #1 --- Chain | Description A | No description available > ui tool show ""Similar Structures"" > foldseek /A Found 404 similar structures to AbLys1_8APP_monom.pdb #1/A in pdb database using foldseek, name fs1 > sequence search /A Traceback (most recent call last): File ""/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site- packages/chimerax/similarstructures/gui.py"", line 239, in _search run(self.session, cmd) File ""/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site- packages/chimerax/core/commands/run.py"", line 49, in run results = command.run(text, log=log, return_json=return_json) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File ""/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site- packages/chimerax/core/commands/cli.py"", line 3237, in run result = ci.function(session, **kw_args) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File ""/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site- packages/chimerax/similarstructures/mmseqs2_search.py"", line 39, in mmseqs2_search Mmseqs2WebQuery(session, chain, database=database, File ""/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site- packages/chimerax/similarstructures/mmseqs2_search.py"", line 73, in __init__ chain_hits = add_chains_descrip_species(entity_hits) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File ""/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site- packages/chimerax/similarstructures/mmseqs2_search.py"", line 206, in add_chains_descrip_species pdb_info = fetch_pdb_entity_info(set(entity_ids)) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File ""/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/site- packages/chimerax/similarstructures/mmseqs2_search.py"", line 260, in fetch_pdb_entity_info f = urlopen(req) ^^^^^^^^^^^^ File ""/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/urllib/request.py"", line 216, in urlopen return opener.open(url, data, timeout) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File ""/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/urllib/request.py"", line 525, in open response = meth(req, response) ^^^^^^^^^^^^^^^^^^^ File ""/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/urllib/request.py"", line 634, in http_response response = self.parent.error( ^^^^^^^^^^^^^^^^^^ File ""/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/urllib/request.py"", line 563, in error return self._call_chain(*args) ^^^^^^^^^^^^^^^^^^^^^^^ File ""/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/urllib/request.py"", line 496, in _call_chain result = func(*args) ^^^^^^^^^^^ File ""/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/urllib/request.py"", line 643, in http_error_default raise HTTPError(req.full_url, code, msg, hdrs, fp) urllib.error.HTTPError: HTTP Error 415: Unsupported Media Type urllib.error.HTTPError: HTTP Error 415: Unsupported Media Type File ""/Applications/ChimeraX-1.11.1.app/Contents/Library/Frameworks/Python.framework/Versions/3.11/lib/python3.11/urllib/request.py"", line 643, in http_error_default raise HTTPError(req.full_url, code, msg, hdrs, fp) See log for complete Python traceback. OpenGL version: 4.1 Metal - 90.5 OpenGL renderer: Apple M1 Pro OpenGL vendor: Apple Python: 3.11.9 Locale: en_US.UTF-8 Qt version: PyQt6 6.9.1, Qt 6.9.0 Qt runtime version: 6.9.2 Qt platform: cocoa Hardware: Hardware Overview: Model Name: MacBook Pro Model Identifier: MacBookPro18,1 Model Number: Z14Y000JEY/A Chip: Apple M1 Pro Total Number of Cores: 10 (8 Performance and 2 Efficiency) Memory: 16 GB System Firmware Version: 18000.120.36 OS Loader Version: 18000.120.36 Software: System Software Overview: System Version: macOS 26.5 (25F71) Kernel Version: Darwin 25.5.0 Time since boot: 14 hours, 30 minutes Graphics/Displays: Apple M1 Pro: Chipset Model: Apple M1 Pro Type: GPU Bus: Built-In Total Number of Cores: 16 Vendor: Apple (0x106b) Metal Support: Metal 4 Displays: Color LCD: Display Type: Built-in Liquid Retina XDR Display Resolution: 3456 x 2234 Retina Main Display: Yes Mirror: Off Online: Yes Automatically Adjust Brightness: No Connection Type: Internal Installed Packages: aiohappyeyeballs: 2.6.1 aiohttp: 3.13.1 aiosignal: 1.4.0 alabaster: 1.0.0 annotated-types: 0.7.0 anyio: 4.12.1 appdirs: 1.4.4 appnope: 0.1.4 asttokens: 3.0.1 attrs: 25.4.0 babel: 2.17.0 beautifulsoup4: 4.13.5 blockdiag: 3.0.0 blosc2: 3.12.2 build: 1.3.0 certifi: 2025.7.14 cftime: 1.6.5 charset-normalizer: 3.4.4 ChimeraX-AddCharge: 1.5.20 ChimeraX-AddH: 2.2.8 ChimeraX-AlignmentAlgorithms: 2.0.2 ChimeraX-AlignmentHdrs: 3.6.1 ChimeraX-AlignmentMatrices: 2.1 ChimeraX-Alignments: 3.1.1 ChimeraX-AlphaFold: 1.0.1 ChimeraX-AltlocExplorer: 1.2 ChimeraX-AmberInfo: 1.0 ChimeraX-Animations: 1.0 ChimeraX-Aniso: 1.3.2 ChimeraX-Arrays: 1.1 ChimeraX-Atomic: 1.61.4 ChimeraX-AtomicLibrary: 14.2.1 ChimeraX-AtomSearch: 2.0.1 ChimeraX-AxesPlanes: 2.4 ChimeraX-BasicActions: 1.1.3 ChimeraX-BILD: 1.0 ChimeraX-BlastProtein: 3.0.0 ChimeraX-Boltz: 1.1 ChimeraX-BondRot: 2.0.4 ChimeraX-BugReporter: 1.0.2 ChimeraX-BuildStructure: 2.13.1 ChimeraX-Bumps: 1.0 ChimeraX-BundleBuilder: 1.6.0 ChimeraX-ButtonPanel: 1.0.1 ChimeraX-CageBuilder: 1.0.1 ChimeraX-CellPack: 1.0 ChimeraX-Centroids: 1.4 ChimeraX-ChangeChains: 1.1 ChimeraX-CheckWaters: 1.5 ChimeraX-ChemGroup: 2.0.2 ChimeraX-CiliaBuilder: 1.1.0 ChimeraX-Clashes: 2.3 ChimeraX-Clipper: 0.26.1 ChimeraX-clix: 0.2.7 ChimeraX-ColorActions: 1.0.5 ChimeraX-ColorGlobe: 1.0 ChimeraX-ColorKey: 1.5.8 ChimeraX-CommandLine: 1.3.0 ChimeraX-ConnectStructure: 2.0.1 ChimeraX-Contacts: 1.0.1 ChimeraX-Core: 1.11.1 ChimeraX-CoreFormats: 1.2 ChimeraX-coulombic: 1.4.5 ChimeraX-Crosslinks: 1.0 ChimeraX-Crystal: 1.0 ChimeraX-CrystalContacts: 1.0.1 ChimeraX-DAQplugin: 1.0.1 ChimeraX-DataFormats: 1.2.4 ChimeraX-Dicom: 1.2.7 ChimeraX-DistMonitor: 1.4.2 ChimeraX-DockPrep: 1.1.4 ChimeraX-Dssp: 2.0 ChimeraX-EMDB-SFF: 1.0 ChimeraX-ESMFold: 1.0 ChimeraX-FileHistory: 1.0.1 ChimeraX-FunctionKey: 1.0.1 ChimeraX-Geometry: 1.3 ChimeraX-gltf: 1.0 ChimeraX-Graphics: 1.4.1 ChimeraX-Hbonds: 2.5.3 ChimeraX-Help: 1.3 ChimeraX-HKCage: 1.3 ChimeraX-IHM: 1.1 ChimeraX-ImageFormats: 1.2 ChimeraX-IMOD: 1.0 ChimeraX-IO: 1.0.4 ChimeraX-ItemsInspection: 1.0.1 ChimeraX-IUPAC: 1.0 ChimeraX-KVFinder: 1.7.3 ChimeraX-Label: 1.2 ChimeraX-ListInfo: 1.2.2 ChimeraX-Log: 1.2.2 ChimeraX-LookingGlass: 1.1 ChimeraX-Maestro: 1.9.2 ChimeraX-Map: 1.3 ChimeraX-MapData: 2.0 ChimeraX-MapEraser: 1.0.1 ChimeraX-MapFilter: 2.0.1 ChimeraX-MapFit: 2.0 ChimeraX-MapSeries: 2.1.1 ChimeraX-Markers: 1.0.1 ChimeraX-Mask: 1.0.2 ChimeraX-MatchMaker: 2.2.2 ChimeraX-MCopy: 1.0 ChimeraX-MCPServer: 0.1.0 ChimeraX-MDcrds: 2.17.2 ChimeraX-MedicalToolbar: 1.1 ChimeraX-Meeting: 1.0.1 ChimeraX-Minimize: 1.3.2 ChimeraX-MLP: 1.1.1 ChimeraX-mmCIF: 2.16 ChimeraX-MMTF: 2.2 ChimeraX-ModelArchive: 1.0 ChimeraX-Modeller: 1.5.22 ChimeraX-ModelPanel: 1.6 ChimeraX-ModelSeries: 1.0.1 ChimeraX-Mol2: 2.0.3 ChimeraX-Mole: 1.0 ChimeraX-Morph: 1.0.2 ChimeraX-MouseModes: 1.2 ChimeraX-Movie: 1.0.1 ChimeraX-MutationScores: 1.0 ChimeraX-Neuron: 1.0 ChimeraX-Nifti: 1.2 ChimeraX-NIHPresets: 1.2.8 ChimeraX-NMRSTAR: 1.0.2 ChimeraX-NRRD: 1.2 ChimeraX-Nucleotides: 2.0.3 ChimeraX-OpenCommand: 1.15.2 ChimeraX-OrthoPick: 1.0.1 ChimeraX-PDB: 2.7.12 ChimeraX-PDBBio: 1.0.1 ChimeraX-PDBLibrary: 1.0.5 ChimeraX-PDBMatrices: 1.0 ChimeraX-PhenixUI: 1.5.4 ChimeraX-PickBlobs: 1.0.1 ChimeraX-Positions: 1.0 ChimeraX-PresetMgr: 1.1.4 ChimeraX-ProfileGrids: 1.4.2 ChimeraX-PubChem: 2.2 ChimeraX-ReadPbonds: 1.0.1 ChimeraX-Registration: 1.1.2 ChimeraX-RemoteControl: 1.0 ChimeraX-RenderByAttr: 1.6.5 ChimeraX-RenumberResidues: 1.1 ChimeraX-ResidueFit: 1.0.1 ChimeraX-RestServer: 1.3.3 ChimeraX-RNALayout: 1.0 ChimeraX-RotamerLibMgr: 4.0 ChimeraX-RotamerLibsDunbrack: 2.0 ChimeraX-RotamerLibsDynameomics: 2.0 ChimeraX-RotamerLibsRichardson: 2.0 ChimeraX-SaveCommand: 1.5.2 ChimeraX-Scenes: 0.3.1 ChimeraX-SchemeMgr: 1.0 ChimeraX-SDF: 2.0.3 ChimeraX-Segger: 1.0 ChimeraX-Segment: 1.0.1 ChimeraX-Segmentations: 3.5.10 ChimeraX-SelInspector: 1.0 ChimeraX-SeqView: 2.17.3 ChimeraX-Shape: 1.1 ChimeraX-Shell: 1.0.1 ChimeraX-Shortcuts: 1.2.1 ChimeraX-ShowSequences: 1.0.3 ChimeraX-SideView: 1.0.1 ChimeraX-SimilarStructures: 1.0.1 ChimeraX-Smiles: 2.1.2 ChimeraX-SmoothLines: 1.0 ChimeraX-SpaceNavigator: 1.0 ChimeraX-StdCommands: 1.19.1 ChimeraX-STL: 1.0.1 ChimeraX-Storm: 1.0 ChimeraX-StructMeasure: 1.2.1 ChimeraX-Struts: 1.0.1 ChimeraX-Surface: 1.0.1 ChimeraX-SwapAA: 2.0.1 ChimeraX-SwapRes: 2.5.2 ChimeraX-TapeMeasure: 1.0 ChimeraX-TaskManager: 1.0 ChimeraX-Test: 1.0 ChimeraX-Toolbar: 1.2.3 ChimeraX-ToolshedUtils: 1.2.4 ChimeraX-Topography: 1.0 ChimeraX-ToQuest: 1.0 ChimeraX-Tug: 1.0.1 ChimeraX-UI: 1.49.1 ChimeraX-Umap: 1.0 ChimeraX-uniprot: 2.3.2 ChimeraX-UnitCell: 1.0.1 ChimeraX-ViewDock: 1.5.2 ChimeraX-VIPERdb: 1.0 ChimeraX-Vive: 1.1 ChimeraX-VolumeMenu: 1.0.1 ChimeraX-vrml: 1.0 ChimeraX-VTK: 1.0 ChimeraX-WavefrontOBJ: 1.0 ChimeraX-WebCam: 1.0.2 ChimeraX-WebServices: 1.1.5 ChimeraX-Zone: 1.0.1 click: 8.3.1 colorama: 0.4.6 coloredlogs: 15.0.1 comm: 0.2.3 contourpy: 1.3.3 coverage: 7.13.1 cxservices: 1.2.3 cycler: 0.12.1 Cython: 3.1.4 debugpy: 1.8.19 decorator: 5.2.1 docutils: 0.21.2 executing: 2.2.1 filelock: 3.19.1 flatbuffers: 25.12.19 fonttools: 4.61.1 frozenlist: 1.8.0 funcparserlib: 2.0.0a0 glfw: 2.10.0 grako: 3.16.5 h11: 0.16.0 h5py: 3.15.1 html2text: 2025.4.15 httpcore: 1.0.9 httpx: 0.28.1 httpx-sse: 0.4.3 humanfriendly: 10.0 idna: 3.11 ihm: 2.2 imagecodecs: 2024.6.1 imagesize: 1.4.1 iniconfig: 2.3.0 ipykernel: 6.30.1 ipython: 9.5.0 ipython_pygments_lexers: 1.1.1 ipywidgets: 8.1.8 jedi: 0.19.2 Jinja2: 3.1.6 joblib: 1.5.3 jsonschema: 4.26.0 jsonschema-specifications: 2025.9.1 jupyter_client: 8.6.3 jupyter_core: 5.9.1 jupyterlab_widgets: 3.0.16 kiwisolver: 1.4.9 line_profiler: 5.0.0 llvmlite: 0.46.0 lxml: 6.0.2 lz4: 4.3.2 Markdown: 3.8.2 MarkupSafe: 3.0.3 matplotlib: 3.10.7 matplotlib-inline: 0.2.1 mcp: 1.18.0 MolecularDynamicsViewer: 1.6 mpmath: 1.3.0 mrcfile: 1.5.4 msgpack: 1.1.1 multidict: 6.7.0 ndindex: 1.10.1 nest-asyncio: 1.6.0 netCDF4: 1.6.5 networkx: 3.3 nibabel: 5.2.0 nptyping: 2.5.0 numba: 0.64.0 numexpr: 2.14.1 numpy: 1.26.4 onnxruntime: 1.23.2 OpenMM: 8.2.0 openvr: 1.26.701 packaging: 25.0 pandas: 3.0.0 ParmEd: 4.2.2 parso: 0.8.5 pep517: 0.13.1 pexpect: 4.9.0 pickleshare: 0.7.5 pillow: 11.3.0 pip: 25.2 pkginfo: 1.12.1.2 platformdirs: 4.5.1 pluggy: 1.6.0 prompt_toolkit: 3.0.52 propcache: 0.4.1 protobuf: 6.33.5 psutil: 7.0.0 ptyprocess: 0.7.0 pure_eval: 0.2.3 py-cpuinfo: 9.0.0 pybind11: 3.0.1 pycollada: 0.8 pydantic: 2.12.5 pydantic-settings: 2.12.0 pydantic_core: 2.41.5 pydicom: 2.4.4 Pygments: 2.18.0 pynmrstar: 3.3.6 pynndescent: 0.6.0 pynrrd: 1.0.0 PyOpenGL: 3.1.10 PyOpenGL-accelerate: 3.1.10 pyopenxr: 1.1.4501 pyparsing: 3.3.2 pyproject_hooks: 1.2.0 PyQt6-commercial: 6.9.1 PyQt6-Qt6: 6.9.2 PyQt6-WebEngine-commercial: 6.9.0 PyQt6-WebEngine-Qt6: 6.9.2 PyQt6_sip: 13.10.2 pytest: 9.0.2 pytest-cov: 7.0.0 python-dateutil: 2.9.0.post0 python-dotenv: 1.2.1 python-multipart: 0.0.21 pyzmq: 27.1.0 qtconsole: 5.7.0 QtPy: 2.4.3 qtshim: 1.2 RandomWords: 0.4.0 referencing: 0.37.0 requests: 2.32.5 roman-numerals: 4.1.0 roman-numerals-py: 4.1.0 rpds-py: 0.30.0 scikit-learn: 1.8.0 scipy: 1.17.0 scipy: 1.14.0 Send2Trash: 2.1.0 SEQCROW: 1.9.7 setuptools: 80.9.0 sfftk-rw: 0.8.1 six: 1.17.0 snowballstemmer: 3.0.1 sortedcontainers: 2.4.0 soupsieve: 2.8.3 Sphinx: 8.2.3 sphinx-autodoc-typehints: 3.2.0 sphinxcontrib-applehelp: 2.0.0 sphinxcontrib-blockdiag: 3.0.0 sphinxcontrib-devhelp: 2.0.0 sphinxcontrib-htmlhelp: 2.1.0 sphinxcontrib-jsmath: 1.0.1 sphinxcontrib-qthelp: 2.0.0 sphinxcontrib-serializinghtml: 2.0.0 sse-starlette: 3.2.0 stack-data: 0.6.3 starlette: 0.52.1 superqt: 0.7.6 sympy: 1.14.0 tables: 3.10.2 tcia_utils: 1.5.1 threadpoolctl: 3.6.0 tifffile: 2025.3.13 tinyarray: 1.2.5 tornado: 6.5.4 tqdm: 4.67.3 traitlets: 5.14.3 typing-inspection: 0.4.2 typing_extensions: 4.15.0 umap-learn: 0.5.11 urllib3: 2.6.3 uvicorn: 0.40.0 wcwidth: 0.3.2 webcolors: 24.11.1 wheel: 0.45.1 wheel-filename: 1.4.2 widgetsnbextension: 4.0.15 yarl: 1.22.0 }}} " defect new normal Unassigned