﻿id	summary	reporter	owner	description	type	status	priority	milestone	component	version	resolution	keywords	cc	blockedby	blocking	notify_on_close	platform	project
18597	Device loss detected in Present() and crash while running Boltz	chimerax-bug-report@…	Tom Goddard	"{{{
The following bug report has been submitted:
Platform:        Windows-10-10.0.22000
ChimeraX Version: 1.11.dev202508112234 (2025-08-11 22:34:36 UTC)
Description
Last time you used ChimeraX it crashed.
Please describe steps that led to the crash here.
Windows fatal exception: code 0x8001010d

Current thread 0x000041c4 (most recent call first):
  File ""C:\Program Files\ChimeraX 1.11.dev202508112234\bin\Lib\site-packages\chimerax\ui\gui.py"", line 368 in event_loop
  File ""C:\Program Files\ChimeraX 1.11.dev202508112234\bin\Lib\site-packages\chimerax\core\__main__.py"", line 1058 in init
  File ""C:\Program Files\ChimeraX 1.11.dev202508112234\bin\Lib\site-packages\chimerax\core\__main__.py"", line 1223 in 
  File """", line 88 in _run_code
  File """", line 198 in _run_module_as_main
===== Log before crash start =====
> ui tool show Boltz

> boltz predict protein
> ASTSDRDTLLAVKKDWGSPPQLKTWDPAAPNHCNWTGVTCATGGGGVVSGLTLSSMKLTGSVPASVCALKSLTHLDLSYDNLTGDFPGAALYACAGLTFLDLSNNQFSGPLPLDIDRLSPAMEHLNLSTNSFAGEVPPAVGGFPALRSLLLDTNSFTGAYPAAEISKLTGLQMLTLADNEFAPAPVPTEFSKLTNLTYLWMGGMNLTGEIPEAFSSLKELTLFSMASNQLTGSIPAWVWQHQKLQYIYLFDNALSGELTRSVTALNLLQIDLSTNQLTGDIPEDFGNLKNLTILFLYNNQLSGTIPASIGLLPQLKDIRLFQNQLSGELPPELGKHSPLGNLEVSINNLSGPLRESLCANGKLFDIVAFNNSFSGELPAELGDCITINNLMLHNNNFSGDFPEKIWSFPNLTLVMVQNNSFTGTLPAQISPKMARIEIGNNRFSGSFPASAPALKVLHAENNRLGGELPPDMSKLANLTDLSVPGNQISGSIPTSIKLLQKLNSLDMRGNRLSSAIPPGSIGLLPALTMLDLSDNEITGNIPSDVSNVFNLLNLSSNQLTGEVPAQLQSAAYDQSFLGNRLCARADSGTNLPMCPAG
> protein VMQVLDKGSSGGRGPGKGNCDWTKPGHPGCPPKSSS name k7_013498 samples 5

Running Boltz prediction of 2 proteins with 633 residues on gpu  
Using multiple sequence alignment server https://api.colabfold.com  

QDxgiVSyncService: DXGI Factory is no longer Current  

Device loss detected in Present()  

Running boltz prediction failed with exit code 1:  
command:  
C:\Users\wei/boltz2\Scripts\boltz.exe predict
C:\Users\wei/Desktop/boltz_k7_013498\k7_013498.yaml --use_msa_server
--accelerator gpu --no_kernels --diffusion_samples 5  
stdout:  
Boltz version 2.1.1  
Checking input data.  
Processing 1 inputs with 1 threads.  
Generating MSA for C:\Users\wei\Desktop\boltz_k7_013498\k7_013498.yaml with 2
protein entities.  
Running structure prediction for 1 input.  
Predicting: | | 0/? [00:00"", line 198, in _run_module_as_main  
File """", line 88, in _run_code  
File ""C:\Users\wei\boltz2\Scripts\boltz.exe\\__main__.py"", line 7, in   
File ""C:\Users\wei\boltz2\Lib\site-packages\click\core.py"", line 1157, in
__call__  
return self.main(*args, **kwargs)  
^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Users\wei\boltz2\Lib\site-packages\click\core.py"", line 1078, in main  
rv = self.invoke(ctx)  
^^^^^^^^^^^^^^^^  
File ""C:\Users\wei\boltz2\Lib\site-packages\click\core.py"", line 1688, in
invoke  
return _process_result(sub_ctx.command.invoke(sub_ctx))  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Users\wei\boltz2\Lib\site-packages\click\core.py"", line 1434, in
invoke  
return ctx.invoke(self.callback, **ctx.params)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Users\wei\boltz2\Lib\site-packages\click\core.py"", line 783, in
invoke  
return __callback(*args, **kwargs)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Users\wei\boltz2\Lib\site-packages\boltz\main.py"", line 1219, in
predict  
trainer.predict(  
File ""C:\Users\wei\boltz2\Lib\site-
packages\pytorch_lightning\trainer\trainer.py"", line 859, in predict  
return call._call_and_handle_interrupt(  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Users\wei\boltz2\Lib\site-
packages\pytorch_lightning\trainer\call.py"", line 68, in
_call_and_handle_interrupt  
trainer._teardown()  
File ""C:\Users\wei\boltz2\Lib\site-
packages\pytorch_lightning\trainer\trainer.py"", line 1005, in _teardown  
self.strategy.teardown()  
File ""C:\Users\wei\boltz2\Lib\site-
packages\pytorch_lightning\strategies\strategy.py"", line 536, in teardown  
self.lightning_module.cpu()  
File ""C:\Users\wei\boltz2\Lib\site-
packages\lightning_fabric\utilities\device_dtype_mixin.py"", line 82, in cpu  
return super().cpu()  
^^^^^^^^^^^^^  
File ""C:\Users\wei\boltz2\Lib\site-packages\torch\nn\modules\module.py"", line
1150, in cpu  
return self._apply(lambda t: t.cpu())  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Users\wei\boltz2\Lib\site-packages\torch\nn\modules\module.py"", line
928, in _apply  
module._apply(fn)  
File ""C:\Users\wei\boltz2\Lib\site-packages\torchmetrics\metric.py"", line 891,
in _apply  
this._defaults[key] = fn(value)  
^^^^^^^^^  
File ""C:\Users\wei\boltz2\Lib\site-packages\torch\nn\modules\module.py"", line
1150, in   
return self._apply(lambda t: t.cpu())  
^^^^^^^  
torch.AcceleratorError: CUDA error: unknown error  
CUDA kernel errors might be asynchronously reported at some other API call, so
the stacktrace below might be incorrect.  
For debugging consider passing CUDA_LAUNCH_BLOCKING=1  
Compile with `TORCH_USE_CUDA_DSA` to enable device-side assertions.  
  
  

Device loss detected in Present()  


===== Log before crash end =====

Log:
UCSF ChimeraX version: 1.11.dev202508112234 (2025-08-11)  
© 2016-2025 Regents of the University of California. All rights reserved.  
How to cite UCSF ChimeraX  




OpenGL version: 3.3.0 NVIDIA 572.96
OpenGL renderer: NVIDIA GeForce RTX 3060 Ti/PCIe/SSE2
OpenGL vendor: NVIDIA Corporation

Python: 3.11.9
Locale: zh_CN.cp936
Qt version: PyQt6 6.9.1, Qt 6.9.0
Qt runtime version: 6.9.1
Qt platform: windows

Manufacturer: LENOVO
Model: 90TY000BCD
OS: Microsoft Windows 11 家庭中文版 (Build 22000)
Memory: 34,119,708,672
MaxProcessMemory: 137,438,953,344
CPU: 20 12th Gen Intel(R) Core(TM) i7-12700KF
OSLanguage: zh-CN

Installed Packages:
    alabaster: 1.0.0
    appdirs: 1.4.4
    asttokens: 3.0.0
    babel: 2.17.0
    beautifulsoup4: 4.13.4
    blockdiag: 3.0.0
    blosc2: 3.6.1
    build: 1.2.2.post1
    certifi: 2025.8.3
    cftime: 1.6.4.post1
    charset-normalizer: 3.4.3
    ChimeraX-AddCharge: 1.5.19
    ChimeraX-AddH: 2.2.7
    ChimeraX-AlignmentAlgorithms: 2.0.2
    ChimeraX-AlignmentHdrs: 3.6.1
    ChimeraX-AlignmentMatrices: 2.1
    ChimeraX-Alignments: 3.0
    ChimeraX-AlphaFold: 1.0.1
    ChimeraX-AltlocExplorer: 1.1.2
    ChimeraX-AmberInfo: 1.0
    ChimeraX-Aniso: 1.3.2
    ChimeraX-Arrays: 1.1
    ChimeraX-Atomic: 1.60.11
    ChimeraX-AtomicLibrary: 14.1.21
    ChimeraX-AtomSearch: 2.0.1
    ChimeraX-AxesPlanes: 2.4
    ChimeraX-BasicActions: 1.1.3
    ChimeraX-BILD: 1.0
    ChimeraX-BlastProtein: 3.0.0
    ChimeraX-Boltz: 1.1
    ChimeraX-BondRot: 2.0.4
    ChimeraX-BugReporter: 1.0.2
    ChimeraX-BuildStructure: 2.13.1
    ChimeraX-Bumps: 1.0
    ChimeraX-BundleBuilder: 1.6.0
    ChimeraX-ButtonPanel: 1.0.1
    ChimeraX-CageBuilder: 1.0.1
    ChimeraX-CellPack: 1.0
    ChimeraX-Centroids: 1.4
    ChimeraX-ChangeChains: 1.1
    ChimeraX-CheckWaters: 1.5
    ChimeraX-ChemGroup: 2.0.2
    ChimeraX-Clashes: 2.3
    ChimeraX-ColorActions: 1.0.5
    ChimeraX-ColorGlobe: 1.0
    ChimeraX-ColorKey: 1.5.8
    ChimeraX-CommandLine: 1.3.0
    ChimeraX-ConnectStructure: 2.0.1
    ChimeraX-Contacts: 1.0.1
    ChimeraX-Core: 1.11.dev202508112234
    ChimeraX-CoreFormats: 1.2
    ChimeraX-coulombic: 1.4.5
    ChimeraX-Crosslinks: 1.0
    ChimeraX-Crystal: 1.0
    ChimeraX-CrystalContacts: 1.0.1
    ChimeraX-DataFormats: 1.2.4
    ChimeraX-Dicom: 1.2.7
    ChimeraX-DistMonitor: 1.4.2
    ChimeraX-DockPrep: 1.1.4
    ChimeraX-Dssp: 2.0
    ChimeraX-EMDB-SFF: 1.0
    ChimeraX-ESMFold: 1.0
    ChimeraX-FileHistory: 1.0.1
    ChimeraX-FunctionKey: 1.0.1
    ChimeraX-Geometry: 1.3
    ChimeraX-gltf: 1.0
    ChimeraX-Graphics: 1.4.1
    ChimeraX-Hbonds: 2.5.3
    ChimeraX-Help: 1.3
    ChimeraX-HKCage: 1.3
    ChimeraX-IHM: 1.1
    ChimeraX-ImageFormats: 1.2
    ChimeraX-IMOD: 1.0
    ChimeraX-IO: 1.0.4
    ChimeraX-ItemsInspection: 1.0.1
    ChimeraX-IUPAC: 1.0
    ChimeraX-KVFinder: 1.7.1
    ChimeraX-Label: 1.1.14
    ChimeraX-ListInfo: 1.2.2
    ChimeraX-Log: 1.2
    ChimeraX-LookingGlass: 1.1
    ChimeraX-Maestro: 1.9.2
    ChimeraX-Map: 1.3
    ChimeraX-MapData: 2.0
    ChimeraX-MapEraser: 1.0.1
    ChimeraX-MapFilter: 2.0.1
    ChimeraX-MapFit: 2.0
    ChimeraX-MapSeries: 2.1.1
    ChimeraX-Markers: 1.0.1
    ChimeraX-Mask: 1.0.2
    ChimeraX-MatchMaker: 2.2.2
    ChimeraX-MCopy: 1.0
    ChimeraX-MDcrds: 2.17
    ChimeraX-MedicalToolbar: 1.1
    ChimeraX-Meeting: 1.0.1
    ChimeraX-Minimize: 1.2
    ChimeraX-MLP: 1.1.1
    ChimeraX-mmCIF: 2.16
    ChimeraX-MMTF: 2.2
    ChimeraX-ModelArchive: 1.0
    ChimeraX-Modeller: 1.5.22
    ChimeraX-ModelPanel: 1.5.1
    ChimeraX-ModelSeries: 1.0.1
    ChimeraX-Mol2: 2.0.3
    ChimeraX-Mole: 1.0
    ChimeraX-Morph: 1.0.2
    ChimeraX-MouseModes: 1.2
    ChimeraX-Movie: 1.0.1
    ChimeraX-MutationScores: 1.0
    ChimeraX-Neuron: 1.0
    ChimeraX-Nifti: 1.2
    ChimeraX-NMRSTAR: 1.0.2
    ChimeraX-NRRD: 1.2
    ChimeraX-Nucleotides: 2.0.3
    ChimeraX-OpenCommand: 1.15.1
    ChimeraX-OrthoPick: 1.0.1
    ChimeraX-PDB: 2.7.10
    ChimeraX-PDBBio: 1.0.1
    ChimeraX-PDBLibrary: 1.0.4
    ChimeraX-PDBMatrices: 1.0
    ChimeraX-PickBlobs: 1.0.1
    ChimeraX-Positions: 1.0
    ChimeraX-PresetMgr: 1.1.3
    ChimeraX-ProfileGrids: 1.1.4
    ChimeraX-PubChem: 2.2
    ChimeraX-ReadPbonds: 1.0.1
    ChimeraX-Registration: 1.1.2
    ChimeraX-RemoteControl: 1.0
    ChimeraX-RenderByAttr: 1.6.4
    ChimeraX-RenumberResidues: 1.1
    ChimeraX-ResidueFit: 1.0.1
    ChimeraX-RestServer: 1.3.1
    ChimeraX-RNALayout: 1.0
    ChimeraX-RotamerLibMgr: 4.0
    ChimeraX-RotamerLibsDunbrack: 2.0
    ChimeraX-RotamerLibsDynameomics: 2.0
    ChimeraX-RotamerLibsRichardson: 2.0
    ChimeraX-SaveCommand: 1.5.2
    ChimeraX-Scenes: 0.1
    ChimeraX-SchemeMgr: 1.0
    ChimeraX-SDF: 2.0.3
    ChimeraX-Segger: 1.0
    ChimeraX-Segment: 1.0.1
    ChimeraX-Segmentations: 3.5.7
    ChimeraX-SelInspector: 1.0
    ChimeraX-SeqView: 2.17.2
    ChimeraX-Shape: 1.1
    ChimeraX-Shell: 1.0.1
    ChimeraX-Shortcuts: 1.2.1
    ChimeraX-ShowSequences: 1.0.3
    ChimeraX-SideView: 1.0.1
    ChimeraX-SimilarStructures: 1.0.1
    ChimeraX-Smiles: 2.1.2
    ChimeraX-SmoothLines: 1.0
    ChimeraX-SpaceNavigator: 1.0
    ChimeraX-StdCommands: 1.19.1
    ChimeraX-STL: 1.0.1
    ChimeraX-Storm: 1.0
    ChimeraX-StructMeasure: 1.2.1
    ChimeraX-Struts: 1.0.1
    ChimeraX-Surface: 1.0.1
    ChimeraX-SwapAA: 2.0.1
    ChimeraX-SwapRes: 2.5.2
    ChimeraX-TapeMeasure: 1.0
    ChimeraX-TaskManager: 1.0
    ChimeraX-Test: 1.0
    ChimeraX-Toolbar: 1.2.3
    ChimeraX-ToolshedUtils: 1.2.4
    ChimeraX-Topography: 1.0
    ChimeraX-ToQuest: 1.0
    ChimeraX-Tug: 1.0.1
    ChimeraX-UI: 1.48
    ChimeraX-Umap: 1.0
    ChimeraX-uniprot: 2.3.1
    ChimeraX-UnitCell: 1.0.1
    ChimeraX-ViewDock: 1.2.2
    ChimeraX-VIPERdb: 1.0
    ChimeraX-Vive: 1.1
    ChimeraX-VolumeMenu: 1.0.1
    ChimeraX-vrml: 1.0
    ChimeraX-VTK: 1.0
    ChimeraX-WavefrontOBJ: 1.0
    ChimeraX-WebCam: 1.0.2
    ChimeraX-WebServices: 1.1.5
    ChimeraX-Zone: 1.0.1
    colorama: 0.4.6
    comm: 0.2.3
    comtypes: 1.4.11
    contourpy: 1.3.3
    coverage: 7.10.3
    cxservices: 1.2.3
    cycler: 0.12.1
    Cython: 3.1.2
    debugpy: 1.8.16
    decorator: 5.2.1
    docutils: 0.21.2
    executing: 2.2.0
    filelock: 3.18.0
    fonttools: 4.59.0
    funcparserlib: 2.0.0a0
    glfw: 2.9.0
    grako: 3.16.5
    h5py: 3.14.0
    html2text: 2024.2.26
    idna: 3.10
    ihm: 2.2
    imagecodecs: 2024.6.1
    imagesize: 1.4.1
    iniconfig: 2.1.0
    ipykernel: 6.29.5
    ipython: 8.26.0
    ipywidgets: 8.1.7
    jedi: 0.19.1
    Jinja2: 3.1.6
    jupyter_client: 8.6.3
    jupyter_core: 5.8.1
    jupyterlab_widgets: 3.0.15
    kiwisolver: 1.4.9
    line_profiler: 5.0.0
    lxml: 5.3.1
    lz4: 4.3.2
    Markdown: 3.8.2
    MarkupSafe: 3.0.2
    matplotlib: 3.10.1
    matplotlib-inline: 0.1.7
    msgpack: 1.1.0
    ndindex: 1.10.0
    nest-asyncio: 1.6.0
    netCDF4: 1.6.5
    networkx: 3.3
    nibabel: 5.2.0
    nptyping: 2.5.0
    numexpr: 2.11.0
    numpy: 1.26.4
    nvidia-nvjitlink-cu12: 12.9.86
    OpenMM: 8.2.0
    OpenMM-CUDA-12: 8.2.0
    openvr: 1.26.701
    packaging: 25.0
    ParmEd: 4.2.2
    parso: 0.8.4
    pep517: 0.13.1
    pickleshare: 0.7.5
    pillow: 10.4.0
    pip: 25.2
    pkginfo: 1.12.1.2
    platformdirs: 4.3.8
    pluggy: 1.6.0
    prompt_toolkit: 3.0.51
    psutil: 7.0.0
    pure_eval: 0.2.3
    py-cpuinfo: 9.0.0
    pycollada: 0.8
    pydicom: 2.4.4
    Pygments: 2.18.0
    pynmrstar: 3.3.5
    pynrrd: 1.0.0
    PyOpenGL: 3.1.9
    PyOpenGL-accelerate: 3.1.9
    pyopenxr: 1.1.4501
    pyparsing: 3.2.3
    pyproject_hooks: 1.2.0
    PyQt6-commercial: 6.9.1
    PyQt6-Qt6: 6.9.1
    PyQt6-WebEngine-commercial: 6.9.0
    PyQt6-WebEngine-Qt6: 6.9.1
    PyQt6_sip: 13.10.2
    pytest: 8.4.1
    pytest-cov: 6.2.1
    python-dateutil: 2.9.0.post0
    pytz: 2025.2
    pywin32: 310
    pyzmq: 27.0.1
    qtconsole: 5.5.2
    QtPy: 2.4.3
    qtshim: 1.2
    RandomWords: 0.4.0
    requests: 2.32.4
    roman-numerals-py: 3.1.0
    scipy: 1.14.0
    setuptools: 80.9.0
    sfftk-rw: 0.8.1
    six: 1.17.0
    snowballstemmer: 3.0.1
    sortedcontainers: 2.4.0
    soupsieve: 2.7
    Sphinx: 8.2.3
    sphinx-autodoc-typehints: 3.1.0
    sphinxcontrib-applehelp: 2.0.0
    sphinxcontrib-blockdiag: 3.0.0
    sphinxcontrib-devhelp: 2.0.0
    sphinxcontrib-htmlhelp: 2.1.0
    sphinxcontrib-jsmath: 1.0.1
    sphinxcontrib-qthelp: 2.0.0
    sphinxcontrib-serializinghtml: 2.0.0
    stack-data: 0.6.3
    superqt: 0.7.5
    tables: 3.10.2
    tcia_utils: 1.5.1
    tifffile: 2025.3.13
    tinyarray: 1.2.5
    tornado: 6.5.2
    traitlets: 5.14.3
    typing_extensions: 4.14.1
    tzdata: 2025.2
    urllib3: 2.5.0
    wcwidth: 0.2.13
    webcolors: 24.11.1
    wheel: 0.45.1
    wheel-filename: 1.4.2
    widgetsnbextension: 4.0.14
    WMI: 1.5.1
}}}
"	defect	closed	normal		Structure Prediction		can't reproduce						all	ChimeraX
