# Fetch ID
open 6NQ3

# Set up the structures to view
select all ; show sel cartoons; style sel stick; hide sel atoms
select /A,B,C,G,D,H ; hide sel cartoons
select /E ; color (#!1 & sel) purple
select /F ; color (#!1 & sel) cyan
select clear

# Set starting view
set bgColor white
lighting soft
graphics silhouettes true
view
view name start

# Start the movie production
movie record supersample 1 size 720,720 limit 5000 directory ~/Desktop/tmp_chimera pattern Frame_n*

# Set starting through the hole of Rbbp4
turn z -70
turn x 24
turn y -40
view name hole
wait 5

# colour Histone-binding protein RBBP4 or subunit C of CAF1 complex; Region: CAF1C_H4-bd; pfam12265
select sequence EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLP ; color sel orange
select clear ; wait 10

# Colour the WD40 repeat 1
select sequence NHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYT ; color sel spring green
select clear ; wait 10
# Colour the WD40 repeat 2
select sequence GHQKEGYGLSWNPNLSGHLLSASDDHTICLWD ; color sel spring green
select clear ; wait 10
# WD40 repeat 3
select sequence GHTAVVEDVSWHLLHESLFGSVADDQKLMIWD ; color sel spring green
select clear ; wait 10
# WD40 repeat 4
select sequence AHTAEVNCLSFNPYSEFILATGSADKTVALWD ; color sel spring green
select clear ; wait 10
# WD40 repeat 5
select sequence SHKDEIFQVQWSPHNETILASSGTDRRLNVWD ; color sel spring green
select clear ; wait 10
# WD40 repeat 6
select sequence GHTAKISDFSWNPNEPWVICSVSEDNIMQVWQ ; color sel spring green
select clear ; wait 10

# Show altenative exon
select sequence RKTFKVDDMLSKVEKMKGEQESH
color sel red
select clear
wait 10


# All structure overview
turn x 20 120 rock 120 ; wait
turn y 35 150 rock 150 ; wait
turn y 4 90 ; wait


# Show first point of interaction with yellow region
turn y 1 50 ; wait
turn x 1 35 ; wait
zoom 1.5 80 ; wait
move x 0.75 15 ; move y -0.75 15 ; wait
view name side

# Show side chains interacting
select /E:9-28 /E:32-39
show sel atoms
hbonds sel
select clear
wait 20
turn x 15 60 rock 60 ; wait
turn y 15 60 rock 60; wait

# remove hydrogen bonds and
~hbonds
select /E:9-28 /E:32-39
hide sel atoms
select clear
wait 5

# go back
move y 0.75 15 ; move x -0.75 15 ; wait
zoom 0.5 80 ; wait
turn -x 1 35 ; wait
turn -y 1 50 ; wait
view hole
# the going back to 'hole' position is a bit abrupt

# Close up to region 1
move x 0.75 25 ; move y -0.5 25 ; wait 25
turn x 0.5 25 ; zoom 3 80 ; wait 80
turn x 0.75 25 ; move y 0.5 25 ; wait 25
view name zoom1

# Show residues interacting with R129
select /F:129 /E:409 /E:346 ; show sel atoms; color (#!1 & sel) byelement ; hbonds sel
select clear
wait 15
turn -y 15 120 rock 120 ; wait 
turn x 15 60 rock 130 ; wait
wait 15
view name zoom2

# Move to next site Asp 129
turn y -1.5 25 ; move x -0.5 25 ; wait 25
turn x -1 25  ; turn z 1 25  ; move x 0.4 25 ; wait 25

# Show residues interacting with ASP135
select /F:135 /E:285,304,330 ; show sel atoms; color (#!1 & sel) byelement ; hbonds sel
select clear
turn y -10 120 rock 180 ; wait
turn x 15 120 rock 120 ; wait
wait 20 
view name zoom3

# zoom out and move to other region
zoom 0.5 50 ; turn -y 1 150 ; wait
move x 0.75 15 ; wait
turn x 1 20 ; wait
zoom 1.5 50

# Select last interaction area
select /F:370,375 /E:270,309,314
show sel atoms 
hbonds sel
select clear

# Final show 
turn x 15 60 rock 130
turn -y 15 60 rock 130

# Print status in log
movie status

# Export movie
movie encode ~/Desktop/Suz12_test1.mp4 format h264 quality low wait true verbose false
# close